SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000002057 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000002057
Domain Number 1 Region: 13-114
Classification Level Classification E-value
Superfamily POZ domain 9.03e-22
Family BTB/POZ domain 0.0015
Further Details:      
 
Domain Number 2 Region: 518-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000138
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000002057
Domain Number - Region: 493-524
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000127
Family Classic zinc finger, C2H2 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000002057   Gene: ENSSTOG00000002304   Transcript: ENSSTOT00000002300
Sequence length 673
Comment pep:known_by_projection scaffold:spetri2:JH393289.1:9784760:9790575:-1 gene:ENSSTOG00000002304 transcript:ENSSTOT00000002300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESRKLISATDIQYSGSLLNSLNEQRGHGLFCDVTVIVEDRKFRAHRNILSASSTYFHQL
FSVAGQVVELSFIRAEIFAEILNYIYSSKIVRVRADLLDELIKSGQLLGVKFIAELGVPL
SQVKSISGTPQDGSAETLPPDSSDKNLVIQKSKDETQDNGATIMPIITESFSLSAEDYET
KKIIVTDSDDDDDDDDVIFCSEILPAKETLPNNNAVTQVQPNTGPVAISDVAPCASNNSP
PLTNITPTQKLPIPVNQATLSQTQGSEQLLVSSAPTHLTPNIILLNQAPLTTPPNVSSSL
PNHMSSSINLLMQNQQTPNSAVLTGNKASEEEEEEIIDDDDDTISSSPDSAVSNTSLVPQ
ADTSQNTTFDGSLIQKMQIPTLLQEPLSNSLKISDIITRNTNDPGLGSKHLMEGQKIITL
DTATEIEGLSTGCKVYANIGEDTYDIVIPVKDDPDEGEARLENEIPKTSGNESASKRMKV
KHDDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRT
KHEIHHTGERRYQCLACGKSFINYQFMSSHMKSVHSQDPSGDSKLYRLHPCKSLQIRQYA
YLSDRSSTVPVMKDDGIGYKVDAGKEPPVGTTSTQNKPMTWEDIFIQQENDSIFKQNVTD
GSTEFEFIIPESY
Download sequence
Identical sequences I3M057
XP_005319418.1.77405 XP_013211509.1.77405 ENSSTOP00000002057 ENSSTOP00000002057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]