SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000002174 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000002174
Domain Number 1 Region: 130-201
Classification Level Classification E-value
Superfamily RILP dimerisation region 2.35e-16
Family RILP dimerisation region 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000002174   Gene: ENSSTOG00000002438   Transcript: ENSSTOT00000002430
Sequence length 207
Comment pep:known_by_projection scaffold:spetri2:JH393368.1:1318553:1341388:1 gene:ENSSTOG00000002438 transcript:ENSSTOT00000002430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEPPVREEEEGDGEMDEAGPEGALGKSPFQLTTEDVYDISYVVGRELMALGSDPRVTQL
QFKIVRVLEMLEALVDKGSLAAEELRMERDNLRQEVEGLRRRGPPAQGEVNLGPDKMVVD
LTDPNRPRFTLQELRDVLQERNKLKSQLIVVQEELQGYKSGLIAPREGPGGRRRNDTVVT
RACNANSDKEEKTIMKKLFSFRSGKPT
Download sequence
Identical sequences XP_005329615.1.77405 ENSSTOP00000002174 ENSSTOP00000002174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]