SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000002458 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000002458
Domain Number 1 Region: 1542-1716
Classification Level Classification E-value
Superfamily Fibronectin type III 7.7e-29
Family Fibronectin type III 0.0000667
Further Details:      
 
Domain Number 2 Region: 1909-2076
Classification Level Classification E-value
Superfamily Fibronectin type III 1.77e-25
Family Fibronectin type III 0.0000102
Further Details:      
 
Domain Number 3 Region: 910-1078
Classification Level Classification E-value
Superfamily Fibronectin type III 5.56e-24
Family Fibronectin type III 0.00053
Further Details:      
 
Domain Number 4 Region: 1267-1441
Classification Level Classification E-value
Superfamily Fibronectin type III 1.73e-21
Family Fibronectin type III 0.0000128
Further Details:      
 
Domain Number 5 Region: 1727-1897
Classification Level Classification E-value
Superfamily Fibronectin type III 4.23e-21
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 6 Region: 810-900
Classification Level Classification E-value
Superfamily Fibronectin type III 4.92e-21
Family Fibronectin type III 0.00064
Further Details:      
 
Domain Number 7 Region: 409-464
Classification Level Classification E-value
Superfamily Kringle-like 6.28e-21
Family Fibronectin type II module 0.0000527
Further Details:      
 
Domain Number 8 Region: 1449-1539
Classification Level Classification E-value
Superfamily Fibronectin type III 5.34e-20
Family Fibronectin type III 0.00000742
Further Details:      
 
Domain Number 9 Region: 349-404
Classification Level Classification E-value
Superfamily Kringle-like 7.14e-20
Family Fibronectin type II module 0.0000691
Further Details:      
 
Domain Number 10 Region: 1174-1264
Classification Level Classification E-value
Superfamily Fibronectin type III 2.49e-16
Family Fibronectin type III 0.00000468
Further Details:      
 
Domain Number 11 Region: 558-603
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000107
Family Fibronectin type I module 0.0016
Further Details:      
 
Domain Number 12 Region: 619-701
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000513
Family Fibronectin type III 0.00000454
Further Details:      
 
Domain Number 13 Region: 516-560
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000589
Family Fibronectin type I module 0.0045
Further Details:      
 
Domain Number 14 Region: 468-509
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000131
Family Fibronectin type I module 0.002
Further Details:      
 
Domain Number 15 Region: 231-275
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000017
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 16 Region: 2339-2380
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000183
Family Fibronectin type I module 0.0015
Further Details:      
 
Domain Number 17 Region: 94-139
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000275
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 18 Region: 2294-2337
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000523
Family Fibronectin type I module 0.0042
Further Details:      
 
Domain Number 19 Region: 185-230
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000837
Family Fibronectin type I module 0.00015
Further Details:      
 
Domain Number 20 Region: 50-91
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000327
Family Fibronectin type I module 0.00019
Further Details:      
 
Domain Number 21 Region: 142-182
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000034
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 22 Region: 723-810
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000876
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 23 Region: 307-345
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000733
Family Fibronectin type I module 0.00031
Further Details:      
 
Domain Number 24 Region: 2209-2273
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000385
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 25 Region: 1095-1182
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000238
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 26 Region: 2383-2415
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000667
Family Fibronectin type I module 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000002458   Gene: ENSSTOG00000002709   Transcript: ENSSTOT00000002748
Sequence length 2416
Comment pep:known_by_projection scaffold:spetri2:JH393396.1:1708973:1769860:1 gene:ENSSTOG00000002709 transcript:ENSSTOT00000002748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGPGPQLLLLLAVLCLGTAVPSTGASKSKRQAQQIVQPQSPVTVAQSKPGCFDNGKHY
QINQQWERTYLGNALVCTCYGGSRGFNCESKPEPEETCFDKYTGNTYRVGDTYERPKDSM
IWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTC
KPIAEKCFDNAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRSS
YKIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSLQATSSGSGSITDVRKAIYQPPTH
PQPVPYGHCVTDSGVIYSVGMQWLKTQGNKQMLCTCLGNGISCQETAVTQTFGGNSNGEP
CVLPFVYNGRTFYSCTTEGRQDGHLWCSTTWNYEQDQKYSFCTDHTVLVQTRGGNSNGAL
CHFPFLYNNRNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYR
IGDQWDKQHDMGHMMRCTCIGNGRGEWTCVAYSKLRDQCIVDDITYNVNDTFHKRHEEGH
MLNCTCFGQGRGRWQCDPIDQCQDSETRTFYQIGDSWEKHVHGIRYQCYCYGRGIGEWHC
QPLQAYPGTSGPVQVIITETPSQPNSHPIHWNAPEPSHITKYILRWRPKNSVGRWKEATI
PGHLNSYVIKGLTPGVIYEGQLISFQQYGHREVTRFDFTTTSSSTPKGTSNTVTGETTPL
SPVVATSESVTEITASSFVVSWVSASDTLSGFLVVYELSEEGAERRYLELPSTATSVSIP
DLLPGRKYIVNVYQIAEDGEQSLILSTSQTTAPDAPPDPTVGQVDDTSIVVRWSRPQAPI
TGYRIVYAPSEEGGSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVFIQQET
TGTPRSDKVPPPKDLQFVEVTDVKVTIMWTPPDSAVTGYRVDVIPVNLPGEHGQRLPINR
NTFAEVTGLSPGATYYFKVFAVNQGRESKPLIAQQTTKLDAPTNLQFVNESDTSVLVTWT
PPRARISGYRLTVGLTRGGRPKQYNVGPSVSKYPLRNLQPGSEYTVTLVGIKGDQESPKA
TGVFSTLQPSSSIPPFNTEVTETTIVITWIPVPRIGFKLGVRPSQGGEAPREVTSDSGSI
VVSGLTPGVEYDYSVQVLRDGKEIEQPIVNRVVTPLSPPTNLHLEANPDTGELTVSWERS
TTPGITGYRITTTPTSGQQGNALEEMVRADQSSCTFENLSPGLEYNVSVYTVKDDKESVP
ISDTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDS
SVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNVGPDTMRVTW
APPSSIELSNLLVRYSPVKNEDDVAELSISPSDNAVVLTNLLPGTEYLVSVSSVYEHHES
IPLKGRQKTRLDSPSGIDFSDITPNSFTVHWIAPRAAITGYWIRHHPEHSAGRPREDRVP
PSRNSITLTNLNPGTEYVVSIVALYGREESSPLIGQQSTVSDVPRDLEVIASTPTSVLIS
WEAPAVTVRYYRITYGETGGTSPVQEFTVPGSKSTATISDLKPGVDYTITVYAVTGRGDS
PASSKPISIDYRTEIDKPSQMQVTDVKDNSISVRWLPSSSPITGYRVTTIPKTGKGPSQT
RTAGPDQTEMTIEGLQPTVEYVVSVYAQNGKGESQPLVQTAVTNIDRPKGLAFTDVDVDS
IKIAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHD
DMESQPLIGTQSTAIPAPTNLRFTQITPTSFSAQWTPPNVQLTGYRIRVTPKDKKTGPMK
EINLAPDSTSVVVSGLMVATKYEVSVYALKDTLTSRPAQGIITTLENVSPPRRARVTDAT
ETTITINWRTKTETITGFQVDAIPANGQTPVQRTIGPDVRSYTITGLQPGTDYKIYLYTL
NDNAHSSPVVIDASTAIDAPSNLRFLTTTPNSLLVAWQPPRAKITGYIIKYEKPGSPPRE
VVPRPQPGVTEATITGLEPGTEYTIYIIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLQ
GPEILDVPSTVPKTPFITSPGADNGNGIHLPGTSHRQPSFGQQMVIEEHGFRRTTPPTAV
TPVRHRPRPYSPTIDEIHVPRGEVDYHLYPHITELNPNASTGQEVLSQTTISWTPFQDSS
EYIISCQPIGTTEEPLQFRVPGTSTSATLTGLTRGATYNILVEAMKNLKRHKVLEEVVTV
GNPVLIGPNQPIDDTCFDPYSASHYDIGDEWERISETGFKLTCQCLGFGSGHFRCDSSKW
CYDNGVNYKIGEKWTRRADTGEMLSCTCLGNGKGEFKCDPDGTTCYDDGKVYQVGERWQK
EFLGAICSCTCFGGQQ
Download sequence
Identical sequences ENSSTOP00000002458 ENSSTOP00000002458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]