SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000002476 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000002476
Domain Number 1 Region: 108-270
Classification Level Classification E-value
Superfamily C-type lectin-like 4.05e-19
Family C-type lectin domain 0.0069
Further Details:      
 
Domain Number 2 Region: 33-72
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000113
Family LDL receptor-like module 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000002476
Domain Number - Region: 269-334
Classification Level Classification E-value
Superfamily FnI-like domain 0.000963
Family VWC domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000002476   Gene: ENSSTOG00000002774   Transcript: ENSSTOT00000002769
Sequence length 559
Comment pep:known_by_projection scaffold:spetri2:JH393429.1:3035872:3095510:-1 gene:ENSSTOG00000002774 transcript:ENSSTOT00000002769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLELIGVRALLFQVLLLLPLLQWPLSFGSTELRCNPGQFACRSGAIHCIPLPWQCDGLAA
CEDESDEADCPEVTGETRPYHGKEAVDPRQGRARGGDPTHFHAVNVAQPVRFSSFLGKCP
TGWHHYEGTASCYRVYLSGENYWDAAQTCQRVNGSLATFSTDQELRFILAQEWDQPERSF
GWKDQRKLWVGYQYVITGRNHSLEGRWEVAFKGSSEVFLPPDPIFASAMSENDNVFCAQL
QCFHFPTLRHHDLHSWHAESCYEKSSFLCKRSQTCVDIKDNVVDEGFYFTPKGDDPCLSC
TCHGGEPEMCVAALCERPQGCQQYRKDPKECCKFMCLDPDGNSLFDSMASGMRLVVSCIS
SFLILSLLLFMVHRLRQRRRERIESLIGANSFDGPVHHFNLGRRIPGFDYGPDGFGTGLT
PLHLSDDGEGGTFHFHDPPPPYTAYKYPDIDQPDDPPPPYEASINPDSVFYDPSDDDAFE
PVEAGPLNPGDGDTEGALPRHLEQPLPPAGASLADLEDSADSSSTLLVPPEPPQSGNNPT
AEVPPVSGCHNRGSLNTMV
Download sequence
Identical sequences ENSSTOP00000002476 ENSSTOP00000002476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]