SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000002769 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000002769
Domain Number 1 Region: 487-723
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.24e-58
Family Eukaryotic proteases 0.0000000115
Further Details:      
 
Domain Number 2 Region: 117-211
Classification Level Classification E-value
Superfamily Kringle-like 1.96e-35
Family Kringle modules 0.00000629
Further Details:      
 
Domain Number 3 Region: 212-296
Classification Level Classification E-value
Superfamily Kringle-like 1.14e-33
Family Kringle modules 0.00019
Further Details:      
 
Domain Number 4 Region: 304-387
Classification Level Classification E-value
Superfamily Kringle-like 7.97e-32
Family Kringle modules 0.00018
Further Details:      
 
Domain Number 5 Region: 383-479
Classification Level Classification E-value
Superfamily Kringle-like 1.55e-27
Family Kringle modules 0.00044
Further Details:      
 
Domain Number 6 Region: 38-127
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 1.53e-21
Family Hairpin loop containing domain 0.00000541
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000002769   Gene: ENSSTOG00000003087   Transcript: ENSSTOT00000003098
Sequence length 731
Comment pep:known_by_projection scaffold:spetri2:JH393544.1:356562:428403:-1 gene:ENSSTOG00000003087 transcript:ENSSTOT00000003098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVTKLLPVLLLQHVLLHLLLLPIAIPYAVIEGQKKRRNTLHEFKKSAKTTLIKEDPLLK
IKTKKMNTPDQCANRCIRNKGLPFTCKAFVFDKTRKRCLWLPFNSMSSGVKKEFGHEFDL
YENKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCR
NPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKICQRWDHQ
TPHRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKMCAHSTMNDTDV
PMETTECIQGQGEGYRGTINTIWNGIPCQRWDSQYPHQHDITPENFKCKDLRENYCRNPD
GAESPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRFGLTCSMWEKN
MEDLHRHIFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIV
NLDHPVISCAKTKQLRVVNGIPTRTNVGWMVSLKYRNKHICGGSLIKESWVLTARQCFPA
RNKDLKEYEAWLGIHDVHGRDEKRKQVLNVSQLVYGPEGSDLVLLKLARPAVLDNFVSTI
DLPNYGCTIPEKTTCSVYGWGYTGLINSDGLLRVAHLYIMGNEKCSQHHQGKVTLNESEI
CAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIH
KIILTYKVTQS
Download sequence
Identical sequences ENSSTOP00000002769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]