SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000002921 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000002921
Domain Number 1 Region: 257-435
Classification Level Classification E-value
Superfamily ITPase-like 2.57e-30
Family YjjX-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000002921   Gene: ENSSTOG00000003266   Transcript: ENSSTOT00000003269
Sequence length 443
Comment pep:known_by_projection scaffold:spetri2:JH393314.1:812645:838997:1 gene:ENSSTOG00000003266 transcript:ENSSTOT00000003269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEESGIETTPPGTPPPNPAGLAAATMSSCFPAASSSFSSPNVSVVDSLPPQVYPTPPPA
HPPVQPTAPLPFVPPVPAPSVPPLGTSGPSAVSPSIAAAFTSPPLSHFPPSTSAPSALVP
APASGPPISGFSVGTTYDITRGHAGRAPQTPLMPSFSAPPVTGVLPTPISQQASLTSLAP
GTGTTSAITFPEEQEDPRINRGQDEASAGGIWGFIKGVAGNPMVKSVLDKTKHSVESMIT
TLDPGMAPYIKSGGELDIVVTSNKEVKVAAVRDAFQEVFGLAVVVGEAGQSNIAPQPVGY
AAGLKGAQERIDSLRRTGVIHEKQTAVSVEHFIAELLPDKWFDIGCLIVEDPVHGIHLEA
FTQATPVPLEFVQQAQSLTPQDYNLRWSGLLVTVGEVLEKSLLNVSRTDWHMAFTGMSRR
QMIYSAAKAIAGMYKQRLPLRTM
Download sequence
Identical sequences ENSSTOP00000002921 ENSSTOP00000002921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]