SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000003033 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000003033
Domain Number 1 Region: 306-392
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000537
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00094
Further Details:      
 
Domain Number 2 Region: 146-198
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000943
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.031
Further Details:      
 
Domain Number 3 Region: 45-97
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000641
Family HLH, helix-loop-helix DNA-binding domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000003033   Gene: ENSSTOG00000003396   Transcript: ENSSTOT00000003389
Sequence length 592
Comment pep:known_by_projection scaffold:spetri2:JH393474.1:799867:813931:1 gene:ENSSTOG00000003396 transcript:ENSSTOT00000003389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPYPGSGGGSEVKCGGGRGASVPWDFLPGLMVKAPPGPCLQAQRKEKSRNAARSRRGK
ENLEFFELAKLLPLPGAISSQLDKASIVRLSVTYLRLRRFAALGAPPWGLRAVGPPAGLA
SGRRGPAALVSEVFEQHLGGHILQSLDGFVFALNQEGKFLYISETVSIYLGLSQVELTGS
SVFDYIHPGDHSEVLEQLGLRTPTPGPPTPPSVSSSSSSSSSSLADAPEIETSPAEGPAS
SRVQERSFFIRMKSTLTKRGLHVKASGYKVIHVTGRLRARALGLVALGHTLPPAPLAELP
LHGHMIVFRLSLGLTILACESRVSDHMDLGPSELVGRSCYQFVHGQDATRIRQSHLDLLD
KGQVMTGYYRWLQRAGGFVWLQSVATVAGSGKSPGEHHVLWVSHVLSQAECGQTPLDAFQ
LPASVPCEDTSSPGPEHTEREPPVERKQVVPADKDEAPQTHGKRIKVEPAPRERQGLEDS
GDEEPSKRPAPPRREFTSVIRAGALKQDPVRPWGLAPPGDPPPALLHAGFLPPVVRSLCT
PGAIRYGPAELGLVYPHLPRLGPGPALPEAFYPSLGLPYPGPPGTRVSRKGD
Download sequence
Identical sequences I3M272
XP_005336629.1.77405 ENSSTOP00000003033 ENSSTOP00000003033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]