SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000003498 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000003498
Domain Number 1 Region: 428-968
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.57e-128
Family alpha-mannosidase, C-terminal domain 0.0000459
Further Details:      
 
Domain Number 2 Region: 1-307
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 6.67e-89
Family alpha-mannosidase 0.0000225
Further Details:      
 
Domain Number 3 Region: 311-407
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 1.5e-27
Family alpha-mannosidase, domain 2 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000003498   Gene: ENSSTOG00000003905   Transcript: ENSSTOT00000003902
Sequence length 970
Comment pep:known_by_projection scaffold:spetri2:JH393287.1:18543592:18570832:1 gene:ENSSTOG00000003905 transcript:ENSSTOT00000003902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QESMRAYAANVYTSVVAELTNRPQRRFIAVEQEFFRLWWTSVASEKQKYQVHQLLKKGQL
EFVLGGQVMHDEAVTHLDDQILQLTEGHGFLYETFGIRPQFSWHVDPFGASATTPTLFAL
AGFNAHLISRIDYDLKEAMQEAQGLQFVWQGSKSLSAQQQIFTHVMDQFSYCTPSQLSFS
NRSGFYWNGVAVFPEPPPDGVYPNMSEPVTPANIDLYAKELVANVKQRAAWFQTPYILWP
WGCDKQFFNASVQFANMDPLLDHINNRSQELGVSVEYATLGDYFRALHALNISWAVYNHH
DFLPYSSEPFAAWTGFYTSRSMLKGMARRASALLYAGESMFTRYMWPVPHGALDPTWALQ
QLQQLRWAVSEVQHHDAITGTESPKVRDMYMEHLATGMQGVRKIMADVSLGDGKPGAALG
APEGWVSPAFFPCTQSNPRPDGYSASVYNPLAWTVTTIVTLTIHFPRVSVTDEMGHPVPA
QIQNSTKDPSAYDLLILSVIPGLSYRHYRVMPTTEAQEATTMATTLRFKSKLRRHSSSQK
KRLVTMANDCYTVQFDQDTNLMHSIWERESNRTVPLTQEFLEYQANGDVHQGPVSDNYMF
TANKTAVPAWKTVVMELVRGKLVTEVRQYFYRNTTAQNYTFAIHSRLAHVSSDPDQELLC
HRIEQKYRVGPLELNREAILRTSSDISNQKLIYSDNNGYQMQRRPYQAFVNNVIARNYFP
MVQSAFIEDNKSRLVLLSERAHGISSQDNGQVEVMLHRRLWNNLTWNLNYNLTLNDTSIV
SPMLWLLLGPHSVTTALRPRMGLALQHRPIVLVRELASKGVPMALPQEQEAVTLPPNLHL
QILSIPGWNYSRVHTKHRYLRKGHQPKAQADLHRVLLRLHHLYEAKEDPFLSQPVTVDLE
TILRGLGPVVAVKERSLTGTWDIRSLQRWNWRTKTGHQKGHPTSPSRLKKGPIVTVYPKE
IRTFFIDFQQ
Download sequence
Identical sequences ENSSTOP00000003498 ENSSTOP00000003498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]