SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000003519 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000003519
Domain Number 1 Region: 5-353
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 6.8e-73
Family ADP-ribosylglycohydrolase 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000003519   Gene: ENSSTOG00000003926   Transcript: ENSSTOT00000003927
Sequence length 362
Comment pep:known_by_projection scaffold:spetri2:JH393346.1:6502013:6506153:1 gene:ENSSTOG00000003926 transcript:ENSSTOT00000003927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGGLLERYMAAMVLSAAGDALGYFNGKWEFLRDGEKIHKQLAQLGGLEAIDVGHWRVSD
DTVMHLATAEALLEAGKAPNLTRLYSLVAKNYQDCMEDMDGRAPGGASVQNAMQLEPDKP
NGWRIPFNSHEGGCGAAMRAMCIGLRFPHHSQLDMLIQVSIESGRMTHHHPTGYLGALAS
ALFTAYAVNGKPPQQWGKGLMEVLPEAKKYVVQSGYFVEENLRHWSYFQNQWESYLKLRG
ISDGKSAPTFPQPFDVKERDQFYTFLSYSGWGGSSGHDAPMIAYDAILAAGDSWKELAHR
AFFHGGDSDSTAAIAACWWGVMHGFKGVSPSNYEKLEYRHRLEEAARALYSLASEKDAAV
SL
Download sequence
Identical sequences I3M3A0
ENSSTOP00000003519 XP_005327678.1.77405 ENSSTOP00000003519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]