SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000003698 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000003698
Domain Number 1 Region: 931-1268
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 1.01e-114
Family Methionine synthase SAM-binding domain 0.0000000596
Further Details:      
 
Domain Number 2 Region: 22-414
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 1.57e-111
Family Homocysteine S-methyltransferase 0.0000101
Further Details:      
 
Domain Number 3 Region: 371-645
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 6.54e-86
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.00066
Further Details:      
 
Domain Number 4 Region: 770-925
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 2.75e-40
Family Cobalamin (vitamin B12)-binding domain 0.00000279
Further Details:      
 
Domain Number 5 Region: 665-755
Classification Level Classification E-value
Superfamily Methionine synthase domain 2.22e-24
Family Methionine synthase domain 0.000033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000003698   Gene: ENSSTOG00000004093   Transcript: ENSSTOT00000004121
Sequence length 1269
Comment pep:known_by_projection scaffold:spetri2:JH393294.1:16092884:16179815:-1 gene:ENSSTOG00000004093 transcript:ENSSTOT00000004121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPALQDPLQPGGMKKTLQDEIEAILRKRIMVLDGGMGTMIQRYKLSEEKFQGQEFKDHA
KPLKGNNDILSITQPDIIYQIHKEYLVAGADIIETNTFSSTSIAQADYGLEHLAYRMNKC
SAGVARKAAEEITRQTGIKRFVAGALGPTNKTLSVSPSVERPDFRNITFDELVEAYQEQA
RGLLDGGVDILLIETIFDTANAKAALFALQKLFEENYAPRPIFISGTIVDKSGRTLSGQT
GEAFVISVSHADPLCIGLNCALGAAEMRPFIETIGKCTTAYVLCYPNAGLPNTFGDYDET
PSMMAMHLKDFAVDGLVNIVGGCCGSTPDHIREIAEAVKNCKPRVPPATVFEGHMLLSGL
EPFRIGPYTNFVNIGERCNVAGSRKFAKLIMAGNYEEALSIAKLQVEMGAQVLDINMDDG
MLDGPSAMTRFCNLIASEPDIAKVPLCIDSSNFAVIEAGLKCCQGKCIVNSISLKEGEED
FLEKARKIKKFGAAVVIMAFDEEGQATETDVKISICTRAYHLLVKKLGFNPNDIIFDPNI
LTIGTGMEEHNLYAINFIHATRVIKETLPGVRISGGLSNLSFSFRGMDAIREAMHGVFLY
HAIKFGMDMGIVNAGNLPVYDDIHKELLQLCEDLIWNKDPEATEKLLHYAQTHGKGGKKV
IQTDEWRNSPIEQRLEYALVKKGIEKYIIQDTEEARLNQEKYPRPLNIIEGPLMNGMKVV
GDLFGAGKMFLPQVIKSARVMKKAVGHLIPFMEKEREENRVLNCTVEEEDPYQGTIVLAT
VKGDVHDIGKNIVGVVLGCNNFRVIDLGVMTPCDKILKAALDHKAEIIDIIGLSGLITPS
LDEMIFVAKEMERLAIKIPLLIGGATTSRTHTAVKIAPRYSAPVIHVLDASKSVVVCSQL
LDENLKDEFFEEIMEEYEDIRQDHYENLKERKYLPLNQARKNGFHIDWLTEPHPVKPMFI
GTRVFEDYDLQKLVDYIDWKPFFDVWQLRGKYPNRGFPKIFNDKTVGEEARKVYDDAQSM
LSALIGQRKLQARGVVGFWPAQSVQDDIHLYAEGVVPQAAEPIATFHGLRQQAEKDSAST
DSYQCLSDFIAPLHSGIRDYLGLFAVACFGVEELSKAYEDQGDDYSSIMVKALGDRLAEA
FAEELHERVRREFWAYCSSEQLSVPDLRKLRYEGIRPAPGYPSQPDHTEKLTMWRLADIE
QCTGIRLTESLAMAPASAVSGLYFSNLQSKYFAVGKISKDQVEDYALRKNMTVADVEKWL
GPILGYDTD
Download sequence
Identical sequences ENSSTOP00000003698 ENSSTOP00000003698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]