SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000003933 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000003933
Domain Number 1 Region: 51-526
Classification Level Classification E-value
Superfamily ALDH-like 2.88e-123
Family ALDH-like 0.00000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000003933   Gene: ENSSTOG00000004369   Transcript: ENSSTOT00000004384
Sequence length 538
Comment pep:known_by_projection scaffold:spetri2:JH393385.1:6467340:6506006:-1 gene:ENSSTOG00000004369 transcript:ENSSTOT00000004384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWHFARALCVNAAKNSKLLGLWNRPAAFMSTLLINQPHYTWLKELGLREENEGVYNGSWG
GQGEVITTYCPANNEPIARVRQASVADYEETIKKAREAWKVWADIPAPKRGEIVRQIGDA
LREKIQVLGNLVSLEMGKILVEGVGEVQEYVDICDYAVGLSRMIGGPILPSERPGHALIE
QWNPVGLVGIITAFNFPVAVRIFGNLIFIICEEKFRWERNLEKEIMALSSRIIAKVLEDN
KLPGAICSLTCGGADIGTAMAKDERVNLLSFTGSTQVGKQVALMVQERFGRSLLELGGNN
AIIAFEDADLSLVVPSALFAAVGTAGQRCTTARRLFLHENIHDDVVNRLKKAYAQIRVGN
PWDPNVLYGPLHTKQSVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLAHDA
SIAHTETFAPILYVFKFKTEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGIV
NVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ
Download sequence
Identical sequences ENSSTOP00000003933 ENSSTOP00000003933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]