SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000004344 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000004344
Domain Number 1 Region: 242-343
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.11e-29
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000114
Further Details:      
 
Domain Number 2 Region: 96-203
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.57e-16
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.032
Further Details:      
 
Domain Number 3 Region: 15-71
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000093
Family HLH, helix-loop-helix DNA-binding domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000004344   Gene: ENSSTOG00000004833   Transcript: ENSSTOT00000004839
Sequence length 821
Comment pep:known_by_projection scaffold:spetri2:JH393305.1:5770974:5814957:1 gene:ENSSTOG00000004833 transcript:ENSSTOT00000004839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVM
RLTISYLRVRKLLDAGDLDIEDEMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYM
GLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGPVKKGKEQNTQRSFFLRMKCTLTSRGR
TMNIKSATWKVLHCTGHIHVYDTNSNQSQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSK
TFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQV
TTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECV
LKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTET
EDQQLEEVPLYNDVMFPSSSEKLQNINLAMSPLPASETPKPLRSSADPALNQEVALKLEP
NPESLELSFTMPQIQDQPASPSDGSTRQSSPEPNSPSEYCFDVDSDMVNVFKLELVEKLF
AEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSSSPQSVSTISVFQ
QTQIQEPTINTTTATTDELKTVTKDDMEDIKILIASWSPTHAPKETTSATTSSYNDTQSR
TASPNRAGKEVIEQTEKSHPRSPNVVSVTLSQRNTVPEEELNPKILALQNAQRKRKMEQD
GSLFQAVGIGTLLQQPDDRATTTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQ
SMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN
Download sequence
Identical sequences I3M4Y9
ENSSTOP00000004344 ENSSTOP00000004344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]