SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000004431 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000004431
Domain Number 1 Region: 237-294
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000157
Family VWC domain 0.015
Further Details:      
 
Domain Number 2 Region: 164-224
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000628
Family VWC domain 0.0053
Further Details:      
 
Domain Number 3 Region: 311-366
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000251
Family VWC domain 0.0073
Further Details:      
 
Domain Number 4 Region: 124-153
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.0000000558
Family Huristasin-like 0.0076
Further Details:      
 
Domain Number 5 Region: 94-123
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.0000000698
Family Huristasin-like 0.0045
Further Details:      
 
Domain Number 6 Region: 68-94
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.0000237
Family Huristasin-like 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000004431
Domain Number - Region: 30-59
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.00384
Family Huristasin-like 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000004431   Gene: ENSSTOG00000004922   Transcript: ENSSTOT00000004939
Sequence length 367
Comment pep:known_by_projection scaffold:spetri2:JH393473.1:1626096:1803448:-1 gene:ENSSTOG00000004922 transcript:ENSSTOT00000004939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPVKVPGECCPVCEEPTYITIDPPACGELSNCTLTEKDCVYGFKLDHNGCRTCQCKNRE
ELCSGLKRGCALECPFGFLTNAHNCEICQCRPRPKKCRPIMCDKYCPLGYLKNKHGCDIC
RCRKCPELPCSKICPLGFQQDNHGCLICKCREVPASAGPPVLSGTCLSMDGHHHKNEESW
HDGCRECYCHNGREMCALITCPVPACGNPTIHPGQCCPSCADDFVVQKPELSTPSICHAP
GGEYFVEGETWNIDSCTQCTCHSGRVLCETEVCPPLLCQNPSRTQDSCCPQCTDEPLQPS
SSHNESVPSYCKNDEGDIFLAAESWKPDVCTSCVCMDSVISCYSESCPSVSCERPVLRKG
QCCPYCL
Download sequence
Identical sequences ENSSTOP00000004431 ENSSTOP00000004431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]