SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000004608 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000004608
Domain Number 1 Region: 352-619
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.75e-87
Family Eukaryotic proteases 0.00000000118
Further Details:      
 
Domain Number 2 Region: 104-196
Classification Level Classification E-value
Superfamily Kringle-like 1.81e-32
Family Kringle modules 0.00000929
Further Details:      
 
Domain Number 3 Region: 211-296
Classification Level Classification E-value
Superfamily Kringle-like 2.1e-27
Family Kringle modules 0.0000152
Further Details:      
 
Domain Number 4 Region: 45-104
Classification Level Classification E-value
Superfamily GLA-domain 4.21e-19
Family GLA-domain 0.0000836
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000004608   Gene: ENSSTOG00000005130   Transcript: ENSSTOT00000005134
Sequence length 622
Comment pep:known_by_projection scaffold:spetri2:JH393372.1:2372092:2388617:-1 gene:ENSSTOG00000005130 transcript:ENSSTOT00000005134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHVRGLGLSGCLALAALVILVHSQDVFLAPQQALSLLQRVRRANSGFLEELRKGNLERE
CVEERCSYEEAFEALESTSATDVFWAKYTACEPVRKPRANFMECMEGNCAKDLGMNYRGH
VNVTRSGIECQLWKSRYPHKPDINSTTHPGAELQENFCRNPDGSTTGPWCYTTDPTVRRE
ECSVPVCGEERFTVEMTPRSGGSRGNLSPSSEQCVPERGRQYEGKLAVTTHGSPCLSWSS
PQAKALSKDQDFSPEVKLVENFCRNPDGDEEGAWCYVAGQAGDFEYCDLNYCEEAVEEGP
GDALSEDGDGTIGGRTTKEEFQTFFDEKTFGSGEADCGLRPLFEKKTVKDKTEDELLDSY
IDGRIVEGWDAEVGIAPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTE
NDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALLKLKKPITFSEHIH
PVCLPDKQTAASLLQAGYKGRVTGWGNLKETWTTTVSEVQPSVLQVVNLPIVERPVCKAS
TRIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRNGK
YGFYTHVFRLKKWIQKVIDRFG
Download sequence
Identical sequences I3M5J3
ENSSTOP00000004608 ENSSTOP00000004608 XP_005330055.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]