SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000004654 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000004654
Domain Number 1 Region: 1-154
Classification Level Classification E-value
Superfamily Ribosomal protein L22 2.62e-65
Family Ribosomal protein L22 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000004654   Gene: ENSSTOG00000005193   Transcript: ENSSTOT00000005186
Sequence length 185
Comment pep:known_by_projection scaffold:spetri2:JH393307.1:13457285:13460615:1 gene:ENSSTOG00000005193 transcript:ENSSTOT00000005186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRYSLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDVTLKKQCVPF
RRYNGGVGRCAQQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQV
NKAPKMRRRTYRAHGRINPYMSSPCHIEMILTEKEQIVPKPEEEVAQKKKISQKKLKKQK
LMARE
Download sequence
Identical sequences ENSSTOP00000004654 ENSSTOP00000004654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]