SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000004687 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000004687
Domain Number 1 Region: 347-489
Classification Level Classification E-value
Superfamily C-type lectin-like 1.29e-40
Family C-type lectin domain 0.00031
Further Details:      
 
Domain Number 2 Region: 931-1082
Classification Level Classification E-value
Superfamily C-type lectin-like 3.85e-39
Family C-type lectin domain 0.00053
Further Details:      
 
Domain Number 3 Region: 644-778
Classification Level Classification E-value
Superfamily C-type lectin-like 2.41e-38
Family C-type lectin domain 0.000000196
Further Details:      
 
Domain Number 4 Region: 786-924
Classification Level Classification E-value
Superfamily C-type lectin-like 2.8e-38
Family C-type lectin domain 0.00028
Further Details:      
 
Domain Number 5 Region: 1219-1358
Classification Level Classification E-value
Superfamily C-type lectin-like 6.75e-35
Family C-type lectin domain 0.00023
Further Details:      
 
Domain Number 6 Region: 21-152
Classification Level Classification E-value
Superfamily Ricin B-like lectins 5.84e-34
Family Cysteine rich domain 0.000000895
Further Details:      
 
Domain Number 7 Region: 499-637
Classification Level Classification E-value
Superfamily C-type lectin-like 3.81e-32
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 8 Region: 227-344
Classification Level Classification E-value
Superfamily C-type lectin-like 7.42e-30
Family C-type lectin domain 0.00083
Further Details:      
 
Domain Number 9 Region: 1088-1216
Classification Level Classification E-value
Superfamily C-type lectin-like 1.82e-27
Family C-type lectin domain 0.0023
Further Details:      
 
Domain Number 10 Region: 152-210
Classification Level Classification E-value
Superfamily Kringle-like 2.83e-20
Family Fibronectin type II module 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000004687   Gene: ENSSTOG00000005205   Transcript: ENSSTOT00000005224
Sequence length 1455
Comment pep:known_by_projection scaffold:spetri2:JH393330.1:9463135:9534874:-1 gene:ENSSTOG00000005205 transcript:ENSSTOT00000005224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NIDLFVWTHSQMLSFFFLTDTRQFLIYNEDHKRCVEAINPSAVQTAVCNPNAESQKFRWV
SESQIMSVAFKLCLGVPSKTDWVPVTLYACDSKSQFQKWECKNDTLFGIKDEDLFFNYGN
RQEKNIMLYKGSGLWSRWKIYGTTDHLCSRGYEDLYTLLGNANGAACAFPFKFENKWYAD
CTSAGRSDGWLWCGTTTDYDTDKLFGFCPLKFEGSANLWTEDPLTNVLYQINSKSALTWH
QARKSCQQQNAELLSVTEIHEQTYLTGLTSSLTSGLWIGLNSLSFTTGWQWSGGSPFRYL
NWLPGSPSTEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNNTLNTFIIPSESDVPTK
CPSQWWPYAGNCYKIHREQKKIQRDALTACRKEGGDLASIHTIEEFDFIFSQLGYEPNDE
LWIGLNDLKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCVVMKGKDGYWADMACEKP
LDYICKMKSQTQAPETEEAETGCRKGWKRHGFYCYMIGHTLSTFAEANQTCQNEKAYLTT
VEDRYEQAFLTSLVGLRPEKYFWTGLSDIQNKGTFQWTVEEEVRFTHWNSDMPGRKAGCV
AMRTGLAGGLWDVLKCDEKAKFVCKHWAEGVTRPPEPTTTPEPKCPEEWGSTSKTSLCFK
LFAKGKHEKKTWFESRDFCRALGGELASINNKEEQQIIWRLITTSGNYHELFWLGLTYVS
PSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGEPGMSWNDINCEHLNNWICQIQK
GKTLQPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIKSE
SEKKFLWKYINRNGVQTPYFIGLLISLDKKFTWMDGSKVDYVAWATGEPNFANEDENCVT
MYTTSGFWNDINCGYPNAFICQRHNSSINATVMPTTPPSPGGCKEGWSWYNNKCFKIFGF
AEEERKNWQEARKTCIGFKGNLVSIRNEKEQAFLTHLMKDSTFNAWTGLNDVNSEHTFLW
TDGRGVHYTNWGKGYPGGRRSSLSYEDADCVVIIGGKSRDAGMWMDDTCDSKRGYICQTD
PDPSLPYSPTPTPKGGFIKYGESSYSLMKLKLTWYDAETYCKNSNSLISSILDPYSNAFA
WMQMYAFNVPVWIALNSNLTNNEYVWTDKWRMRYTNWAADEPKMKSACVYLDVDGYWKTS
NCNESFYFLCKRSDEIPATEPPQLPGRCPESEHSAWIPFHGHCYYIESSFTRNWGQASLE
CLRMGSTLVSIENAAESSFLSYRVEPLKSKTNFWIGLFRNVEGMWLWINNNPVSFVNWNT
GDPSGERNDCVAVDASSGFWNNIHCSSYKGYICKRPKNIIDSYYKEFMGTTGADSRKMEP
SKPSSNVAGAVVFVILLILVGAGIAAYFLYKKRRVHLPQEGTFENTLYFNSQSSPGTSDM
KDLMSNIEQNEHMVI
Download sequence
Identical sequences ENSSTOP00000004687 ENSSTOP00000004687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]