SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000004717 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000004717
Domain Number 1 Region: 61-128
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000471
Family Growth factor receptor domain 0.0054
Further Details:      
 
Domain Number 2 Region: 125-166
Classification Level Classification E-value
Superfamily FnI-like domain 0.000022
Family Fibronectin type I module 0.068
Further Details:      
 
Domain Number 3 Region: 219-263
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000392
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000004717   Gene: ENSSTOG00000005265   Transcript: ENSSTOT00000005258
Sequence length 365
Comment pep:known_by_projection scaffold:spetri2:JH393489.1:751641:767086:1 gene:ENSSTOG00000005265 transcript:ENSSTOT00000005258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSHLSGQPHPSDMQGLLCSTLLFTGLAQFCCRAQGTGPLDTTEEGPREASEAHQRKQFCH
WPCKCSRQKPRCSPGVSLVRDGCGCCKICAKQPGDICNEADLCDPHKGLYCDYSADRPRY
ETGVCAYLVAVGCEFNRVHYRNGQVFQPNPLFSCLCVSGAIGCTPLFIPQLADSQCSRAK
DGKNSDQSKCGVGPLQRQLSTSFKTMPAFRNLPLSWKRKCLVQATKWTPCSRTCGIGISN
RVTNENSNCKMRKEQRLCYIQPCNSNISHTVKIPKGKRCQPIFQLSKAEKFLFSGCLSTQ
SYKPTFCGICLDKRCCIPNKSKMITIQFDCPNEGSFKWKMLWITSCVCQRNCREPGDMFS
ELLIL
Download sequence
Identical sequences ENSSTOP00000004717 ENSSTOP00000004717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]