SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000004756 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000004756
Domain Number 1 Region: 105-172
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000508
Family VWC domain 0.039
Further Details:      
 
Domain Number 2 Region: 249-316
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000541
Family VWC domain 0.0087
Further Details:      
 
Domain Number 3 Region: 27-93
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000016
Family VWC domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000004756   Gene: ENSSTOG00000005306   Transcript: ENSSTOT00000005306
Sequence length 444
Comment pep:known_by_projection scaffold:spetri2:JH393309.1:4478961:4585351:1 gene:ENSSTOG00000005306 transcript:ENSSTOT00000005306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKYIFSFLLFSLFLEGSKAEQVKHSETYCVFQDKKYRVGEKWHPYLEPYGLVYCVNCICS
ENGNVLCSRVRCPNLHCLSPVHIPHLCCPRCPDSLPPVNSKVTSKSCEYNGTTYQHGELF
VAEGLFQNRQPNQCTQCSCSEGNVYCGLKTCPKLTCAFPVSVPDSCCRVCRGDGELSWEH
SDGDIFRQPANREARHSYHRPHHDPPPNRQAGSLSRFPGARSHRGALMDSQQGSGTIVQI
VINNKHKHGQVCVSNGKTYSHGESWHPNLRAFGIVECVLCTCNVTKQECKKIHCPNRYPC
KYPQKIDGKCCKVCPEELPGQNFDSKGYFCGEETMPVYESVFMEDGETTRKIALETERPP
QVEVHVWTIRKGILQHFHIEKISKRMFEELHHFKLVTRTTMSQWKIFTEGEAQISQMCSS
RVCRTELEDLVKVLYLERSEKGHC
Download sequence
Identical sequences ENSSTOP00000004756 ENSSTOP00000004756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]