SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000004804 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000004804
Domain Number 1 Region: 400-503
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.79e-17
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000004804   Gene: ENSSTOG00000005366   Transcript: ENSSTOT00000005363
Sequence length 1331
Comment pep:known_by_projection scaffold:spetri2:JH393405.1:1367469:1376787:-1 gene:ENSSTOG00000005366 transcript:ENSSTOT00000005363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSNFRNTSSTSLTSQASRPPCSTVVASAPSLFSCPSHGPDMSDPLEEADGGRDPRPGESF
RPGGVPSPGPPQHRPCPGPNLADDTDANSNGSSGNESNGHESRGASQRSSHSSSSGNGKD
SALLETTESSKSTNSQSPSPPSSSIAYSLLSASSEQDNPSTSGCSSEQSARARTQKELMT
ALRELKLRLPPERRGKGRSGTLATLQYALACVKQVQANQEYYQQWSLEEGEPCAMDISTY
TLEELEHITSEYTLRNQDTFSVAVSFLTGRIVYISEQAGVLLRCKRDVFRGARFSELLAP
QDVGVFYGSTAPSRLPTWGTGASAGSGVKDFTQEKSVFCRIRGGPDRDPGPRYQPFRLTP
YVTKIRVSDGAPAQPCCLLIAERIHSGYEAPRIPPDKRIFTTRHTPSCLFQDVDERAAPL
LGYLPQDLLGAPVLLFLHPEDRPLMLAIHKKILQLAGQPFDHSPIRFCARNGEYVTMDTS
WAGFVHPWSRKVAFVLGRHKVRTGPLNEDVFTPPAPSPTLSLDSDIQELSEQIHRLLLQP
VHSSSPTGLCGVGPLMSPGPLHSPGSSSDSNGGDAEGPGPPVPVTFQQICKDVHLVKHQG
QQLFIESRARPLPQPRLPATGTFKTKALPCQTPDPELEAAPALTQAPPPLVPEEAERKEA
SSCSYQQINCLDSILRYLESCNIPSTTKRKCASSSSYTASSASDDDKQRTVPIGAKKDPS
SAVLSGEGAAPRKEPVVGSTLSPLALANKAESVVSVTSQCSFSSTIVHVGDKKPPESDII
MMEELPGLAPGPTPSPAPSPTVAPDPAPDAYRPVGLTKAVLSLHTQKEEQAFLNRFRDLG
RLRGLDNSSTAPSAPGCHHGPAPPSRRHHCRSKAKRSRHHQTPRAEAPCYVSHPSPVPPS
GPWPPPPATTPFPAVVQPYPLPVFSPRESPQPIPPAPTSVPSATFPTPLVTPMVALVLPN
YLFPTTSSYPFGVPQTPAEGPPTPASHSPSPSLPPLPPSPPRRPDSPLFNSRCSSPLQLN
LLQLEEPPRPEGGTVAGGPGSSAGLPPPSEEAAEPEARLVEVTESSNQDALSGSSDLLEL
LLQEDSRSGTGSAASGSLGSGLGSGSGSGSHEGGSTSASITRSSQSSHTSKYFGSIDSSE
AEAGAAQARAEPGDQVIKYVLQDPIWLLMANADQRVMMTYQVPSRDMASVLKQDRERLRA
MQKQQPRFSEDQRRELGAVHSWVRKGQLPRALDVMACVDCGSSSQDPGHSDDPLFSELDG
LGLEPMEEGGGEGGSSGGGGDGDGGIGEGGEEAQAQVEAKVSSSQDSAMEEEEQGGSSSS
PALCAAENGTS
Download sequence
Identical sequences ENSSTOP00000004804 ENSSTOP00000004804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]