SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000004897 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000004897
Domain Number 1 Region: 29-73
Classification Level Classification E-value
Superfamily LysM domain 0.00000000968
Family LysM domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000004897   Gene: ENSSTOG00000005468   Transcript: ENSSTOT00000005474
Sequence length 798
Comment pep:known_by_projection scaffold:spetri2:JH393280.1:37735912:37798840:-1 gene:ENSSTOG00000005468 transcript:ENSSTOT00000005474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFFTDTGQKKTLDKKDGRRMSFQKPKGTIEYTVESRDSLNSIALKFDTTPNELVQLNKLF
SRAVVTGQVLYVPDPEYVSSVESSPSLSPISPLSPTSSEAEFEKTTNTDVIHPKEAAPSS
NFTGIRPARVVSSTSEEEEAFTEKFLKINCKYITSGKGTVSGVLLVTPNNIMFDPHKNDP
LVQENGCEEYGIMCPMEEVMSAAMYKEILDSKIKESLPIELDQLSGKDFCHSKKITGINT
EEMDSRIRDAGNDSASTAPRSTEESLSEDVFTESELSPVREELISSDQLRQDKSSGASSE
SVQTVNQIEVECSVAKSESTSTLDHSKSIGALSHAADLNNLEMSTKGGDTVTDNLQELSA
PKEQSTSIKGHVIQDGFRHEDSLHQEESGKENMPYGETTEFKQKQTVDKGKQGKEQNWDS
ETEVEELRKLWKTHTMQQTKEQRENIQQVSQKEIKHKIISADGHVEGSALLKEKRRNRLH
KFLCLRVGKPMRKTFVSQASATMQQYAQRDKKHEYWFAVPQERTDHLYAFFIQWSPEIYA
EDTGEYTREPGFIVVKKIEESETNEDSTNQAAAREWEVVSVAEYHRRIDALNTEELRTLC
RRLQITTREDLNSKQVAPVKADLESESFRPNLSDPSELLLPDQIEKLTKHLPPRTIGYPW
TLVYGTGKHGTSLKTLYRTMTGLDTPVLMVIKDSDGQVFGALASEPFKVSDGFYGTGETF
VFTFCPEFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHSCKTFGNHT
LSKKEDFFIQDIEIWAFE
Download sequence
Identical sequences ENSSTOP00000004897 ENSSTOP00000004897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]