SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000005171 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000005171
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 1.44e-30
Family N-terminal domain of MutM-like DNA repair proteins 0.000000359
Further Details:      
 
Domain Number 2 Region: 133-244
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.07e-27
Family Middle domain of MutM-like DNA repair proteins 0.00000181
Further Details:      
 
Domain Number 3 Region: 248-290
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.84e-19
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.000093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000005171   Gene: ENSSTOG00000005781   Transcript: ENSSTOT00000005782
Sequence length 368
Comment pep:known_by_projection scaffold:spetri2:JH393281.1:34186710:34192256:1 gene:ENSSTOG00000005781 transcript:ENSSTOT00000005782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGPELHLASHFVNEACRGLVFGGCVEKSSVSRNPEVPFESSAYHISASARGKELRLTL
SPLPGAQPPQEPLALIFRFGMSGSFQLAPADALPPHAHLRFYTAPPAPRLALCFVDIRRF
GHWDPGGKWQPGRGPCVLLEYEQFRENVLRNLSDKAFDRPICEALLDQRFFNGIGNYLRA
EILYRLRIPPFEKARTVLEALQHHRPSPEMTLSQKIRAKLQNPDLLELCHSVPKEVVQLG
GKGYGPEHGEEDFAAFRAWLRCYGMPGMSSLRDRHGRTIWFQGDPGPLAPKGGKSRKKKS
QETQLQPKEKLEDLPPPNKAPSRTPRARRHLPKKTAIQQPEGTSLQQDLKAPTVPEKGRR
KGKQATTG
Download sequence
Identical sequences ENSSTOP00000005171 ENSSTOP00000005171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]