SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000005197 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000005197
Domain Number 1 Region: 12-173
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.21e-36
Family Glyoxalase I (lactoylglutathione lyase) 0.0000000649
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000005197   Gene: ENSSTOG00000005821   Transcript: ENSSTOT00000005810
Sequence length 180
Comment pep:known_by_projection scaffold:spetri2:JH393286.1:20910836:20928098:1 gene:ENSSTOG00000005821 transcript:ENSSTOT00000005810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPATGLTDEVALSCCSDPDPSTKDFLLQQTMLRIKDPKKSLDFYTRVLGMTLIQKLDFPT
MNFSLYFLAYEDKNDFPKDKNEKMAWVFSRKATLELTHNWGTENDETQSYHNGNSDPRGF
GHIGIAVPDVYGACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKIAATIS
Download sequence
Identical sequences ENSSTOP00000005197 ENSSTOP00000005197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]