SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000005238 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000005238
Domain Number 1 Region: 404-579,612-708
Classification Level Classification E-value
Superfamily Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 9.15e-59
Family Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.00042
Further Details:      
 
Domain Number 2 Region: 1123-1179
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.65e-20
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00011
Further Details:      
 
Domain Number 3 Region: 708-751
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000000000000628
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000005238   Gene: ENSSTOG00000005847   Transcript: ENSSTOT00000005856
Sequence length 1179
Comment pep:novel scaffold:spetri2:JH393318.1:3989647:4082107:-1 gene:ENSSTOG00000005847 transcript:ENSSTOT00000005856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSTNPGNWVTFDDDPAFQSSPKSKNFPLENQSVCRPNGLKLNLPGLREFPSGPSSASST
PLSSPIVDFYFSPGPPSNSPLSTPTKDFPGFPGIPKSGVHVLYPIPESSPNCPLVPAGTG
SSLLSTKSTCVSHAFVPKDPSGTPPAPRVGLSDETSPQQAEGGGLQSDAPQFQYFQEDCA
FSSPFWKDEGSASQFTFDPSGSRKTFSSRDREMPMDQKSLNKCSLDYICEKLEHFQSAEH
QDPLGNLSVQCPYAEDSVSSFVPHSLFRSQPKAGWSFMLRIPEKKNMMSSRQWGPIFLKV
LPGGILQMYYEKGLEKPFKEFQLDPHCRLSEPKVENFSVAGKIHTVKIEHVSYTEKRKYH
SKTEVVHEPDVEQMLKLGSTEYRDFLDFLTTVEEELLKLPVVPKPKKNYEEQEISLEIVD
NFWGKVTKEDGKVVESAVITQIYCLCFVNGNVECFLTLNDLGLQKQDECCFEKDPEKKWI
EILDYHFHKCVKGQEFEQSRVVKFVPLDACRFELMRFKTLYDGDELPFSVKSVVVVQGAY
VELQAFVNMAPLAQRPSHSSSSRGCDNIMIHFPVPSQWIKALWTMNLQRQKSLKAKMNRR
ACLGSLHEPESEPVIQVTVGSAKYESAYRAVVWKIDRLPDKNSSPDHPHCLSYKLELGSD
QEIPSDWYPFATVQFSMPESCASRTEVRSLGVESDVQPQKHVQQRACYNIQPKLYRSVIE
DVIEGVRDLFVEEGIEEQVLKDLKQLWETKVLQSKATEDFFRNSVHSPLFTLQLPHSLHQ
TLQSSTASLVIPTGRTLPSFATAELGTSNSSANFTFPGYPIHVPAGVTLQTASGHLYKVN
VPIMVTQTSGRASILQHPVQQVFQQFGHPSMIQTSVSQLNPCSLQATNKSQRMETVLQQP
TILHSGPVDRKLLKNATSDILVPPGNEHKIMPEALLRQQENSQYISLPGVVFPPQILQTD
SNVDPVLSVSASMTQNLHSGPLSLGPQVSFHHMTDAQLHVLKKRMYGCDSVKQPRKIEEP
SSLPVSEKNSNSQMDLNTQVSDDDINEIIQIDGTGDTSSNEEIESIRDVNENEFIGIIDA
GDLKVLEEAGSISNEDSPANSSDDEDAQIDVVEEDPLNSGDDVSEQDVPDLFDTDNVIVC
QYDKIHRSKNKWKFFLKDGVMCFGGRDYVFAKAIGDAEW
Download sequence
Identical sequences ENSSTOP00000005238 ENSSTOP00000005238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]