SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000005332 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000005332
Domain Number 1 Region: 199-323
Classification Level Classification E-value
Superfamily HCP-like 5.93e-25
Family HCP-like 0.0028
Further Details:      
 
Domain Number 2 Region: 359-464
Classification Level Classification E-value
Superfamily HCP-like 1.44e-23
Family HCP-like 0.0014
Further Details:      
 
Domain Number 3 Region: 117-170
Classification Level Classification E-value
Superfamily Kringle-like 2.37e-20
Family Fibronectin type II module 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000005332   Gene: ENSSTOG00000005942   Transcript: ENSSTOT00000005960
Sequence length 465
Comment pep:known_by_projection scaffold:spetri2:JH393298.1:9842161:9903696:-1 gene:ENSSTOG00000005942 transcript:ENSSTOT00000005960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVRVGLTLLLCAVLLGSALASSDEEGSQEESLDSKNSLPSDESVKDHTTTGRVVAGQIF
LDSEESELESHIQEEEESLKNQEGESVAEEISFLESPNPENKDHEEPKKVRKPALTAIEG
TAHGEPCHFPFLFLDKEYEECTSDGREDGRLWCATTYDYKTDEKWGFCETEEEAAKRRQM
QEAETMYLTGMKILNGSNKKSQKREAYRYLQKAASMNHTKALERVSYALLFGDHITQNIQ
AAREMFEKLTEEGSPKGQTALGFLYASGLGVNSSQAKALVYYTFGALGGNLIAHMVLGYR
YWAGIGVLQSCESALTHYRLVANHVASDISLTGGSVVQRIRLPDEVENPGMNSGMLEEDL
IQYYQFLAEKGDVQAQVGLGQLHLHGGRGVEQNHQRAFDYFNLAANAGNSHAMAFLGKMY
SEGSDIVPQSNETALHYFKKAADMGNPVGQSGLGMAYLYGRGVQV
Download sequence
Identical sequences ENSSTOP00000005332 ENSSTOP00000005332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]