SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000005382 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000005382
Domain Number 1 Region: 178-283
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.93e-21
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.00000173
Further Details:      
 
Domain Number 2 Region: 38-102
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000144
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000005382   Gene: ENSSTOG00000005990   Transcript: ENSSTOT00000006014
Sequence length 784
Comment pep:known_by_projection scaffold:spetri2:JH393303.1:7367400:7548158:-1 gene:ENSSTOG00000005990 transcript:ENSSTOT00000006014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQEKSTTDDDVQKSDISSSSQGVIEKESLGPLLLEALDGFFFVVNCEGRIVFVSENVTS
YLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNGVPWPQEATRRNSHTFNCRMLIH
PPDEPGTENQEACQRYEVMQCFTVSQPKSIQEDGEDFQSCLICIARRLPRPPAITGVESF
MTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFFQPQGREPSYARQLFQEVMTRGT
ASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMGIHIIDREHSGLSPQDDTNSGMS
IPRVNPSVNPSISPAHGVARSSTLPPSNSSMVSTRVNRHQSSDLHSSSSHSNSSNNQGSF
GCSPGNQIVANVALNQGQASSQSSNPSLNLNNSPMEGTGISLAQFMSPRRQVTSGLATRA
RMPNNSFPPNIPTLNSPVGMTSSACNNSNRSYSNIPVTSLQGMNEGPNNSVGFSASSPVL
RQMSSQNSPSRLNIQPAKAESKDNKEIASILNEMIQSDNSASDSKPLDSGLLHNNDRLSD
GDSKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKEVLSCTGTSSSASANSSGGTCPSSHS
SLTERHKILHRLLQEGSPSDITTLSVEPDKKDSASTSVSVTGQAQGNSNIKLELDTSKKK
ESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEKKDQMDPCNTNPTPMTKPAPEEIKL
ESQSQFTADLEQFDQLLPTLEKAAQLPGLCETDRMDATVTSVTVKSEILPASLQSTTARP
TSRL
Download sequence
Identical sequences ENSSTOP00000005382 ENSSTOP00000005382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]