SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000005403 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSTOP00000005403
Domain Number - Region: 123-173
Classification Level Classification E-value
Superfamily Cgl1923-like 0.00798
Family Cgl1923-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000005403   Gene: ENSSTOG00000006041   Transcript: ENSSTOT00000006037
Sequence length 265
Comment pep:known_by_projection scaffold:spetri2:JH393390.1:552949:555710:-1 gene:ENSSTOG00000006041 transcript:ENSSTOT00000006037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVT
DRSDARLQYGLLIFGAAVSVLLQEAFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYV
SGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFD
ACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQ
RSLSCRRQEDSRVMVYSALRIPPED
Download sequence
Identical sequences A0A1S3A9S2 I3M762
XP_005331207.1.77405 XP_007531624.1.11023 XP_015358508.1.40921 ENSSTOP00000005403 ENSSTOP00000005403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]