SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000005652 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000005652
Domain Number 1 Region: 145-245,408-479
Classification Level Classification E-value
Superfamily TrmE connector domain 1.31e-43
Family TrmE connector domain 0.0032
Further Details:      
 
Domain Number 2 Region: 96-194,229-398
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.84e-35
Family G proteins 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000005652   Gene: ENSSTOG00000006318   Transcript: ENSSTOT00000006320
Sequence length 479
Comment pep:known_by_projection scaffold:spetri2:JH393406.1:3528557:3561155:-1 gene:ENSSTOG00000006318 transcript:ENSSTOT00000006320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTSAWAPLQLCTSQSSRAPAFGSGATIFALSSGQGRCGIAVIRASGPASSHALRSLTAPR
DLPPARSASLRLLSDPHTGEPLDRALVLWFPGGPQSFTGEDCVEFHVHGGPAVVSGVLQA
LGSVPGLRPAEAGEFTRRAFAHGKLNLTEVEGLADLIHAETEAQRRQALRQLDGELGQLC
RSWAETLTKALAHVEAYIDFGEDDNLEDGVLEQADSEVQGLVVALDAHLRDARRGQRLRS
GAHVVVTGPPNAGKSSLVNLLSQKPVSIVSPEPGTTRDVLEIPVDLAGFPALLSDTAGLR
EGVGPVEQEGVRRARERLGQADLILAVLDASDLASPSSCNFLDTVVDLLGAQSQRLLLVL
NKSDLLPPEGLGPSLDLPRHLLLSCLTREGLGGLLEALKKELAAVCGDPSTGPPLLTRAR
HRHHLQGCLDALGHYTQTRDLALAAEALRVARRHLSHLTGGGGTEEVLDIIFRDFCVGK
Download sequence
Identical sequences ENSSTOP00000005652 ENSSTOP00000005652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]