SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000005706 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000005706
Domain Number 1 Region: 512-704
Classification Level Classification E-value
Superfamily Hemopexin-like domain 4.45e-57
Family Hemopexin-like domain 0.000000028
Further Details:      
 
Domain Number 2 Region: 83-212,386-441
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.72e-33
Family Matrix metalloproteases, catalytic domain 0.000000791
Further Details:      
 
Domain Number 3 Region: 333-387
Classification Level Classification E-value
Superfamily Kringle-like 1.34e-21
Family Fibronectin type II module 0.00012
Further Details:      
 
Domain Number 4 Region: 271-328
Classification Level Classification E-value
Superfamily Kringle-like 2.74e-21
Family Fibronectin type II module 0.00012
Further Details:      
 
Domain Number 5 Region: 215-270
Classification Level Classification E-value
Superfamily Kringle-like 1.83e-20
Family Fibronectin type II module 0.00014
Further Details:      
 
Domain Number 6 Region: 34-101
Classification Level Classification E-value
Superfamily PGBD-like 9.58e-19
Family MMP N-terminal domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000005706   Gene: ENSSTOG00000006380   Transcript: ENSSTOT00000006382
Sequence length 705
Comment pep:known_by_projection scaffold:spetri2:JH393324.1:7038446:7045879:-1 gene:ENSSTOG00000006380 transcript:ENSSTOT00000006382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPLVLALLVLGCCSAAPAQRQPTFVVFPRDLRTTHLTDMQLAQDYLFRYGYTRVAEMHTD
ALSLRPALLLLQKRLSLPQTGQLDSATLKAMRTPRCGVPDLGKFQTFEGDLKWHHHNITY
WIQNYSEDLPRDVIDDAFARAFAVWSAVTPLTFTRVYGREADIVIQFGVAEHGDGYPFDG
KDGLLAHAFPPGPGIQGDAHFDDEELWSLGKGVVVPTYFGNSNGAPCHFPFTFEGRSYSA
CTTDGRTDGAPWCSTTANYDTDRKFGFCPSEKLYTQDGNADGKPCVFPFIFEGNSYSACT
TQGRSDGYRWCATTDNYDQDKLYGFCPTRADATVIGGNSAGELCVFPFTFLGKEYSTCTS
DGRNDGRLWCATTSNFDKDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMY
RFLEGSPLHEDDVKGIQHLYGSRPEPDPRPPSTTTPQPQPTAPPTVCPTAPPTARPSELP
TTGPTGPPSAGPTGPPTAGPSEAPVTLDPVDSPCSVDVFDAIAEIGNYLHVFKDGRYWRF
SEGTGPRLQGPFLIADTWPALPARLDSAFEEPLSKKIFFFSGRQVWVYTGASVLGPRRLD
KLGLGSEVTQVTGVLPRGGGKALLFSGHLFWRFDVKTQRVDSRSPTPVDQMFPGVPLNTH
DIFQYREKAYFCQNRFFWRVSSKKEVNQVDQVGYVTYDLLQCPED
Download sequence
Identical sequences ENSSTOP00000005706 ENSSTOP00000005706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]