SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000005817 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000005817
Domain Number 1 Region: 12-363
Classification Level Classification E-value
Superfamily UROD/MetE-like 9.42e-119
Family Uroporphyrinogen decarboxylase, UROD 0.00000000000364
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000005817   Gene: ENSSTOG00000006505   Transcript: ENSSTOT00000006503
Sequence length 367
Comment pep:known_by_projection scaffold:spetri2:JH393284.1:26207270:26210539:1 gene:ENSSTOG00000006505 transcript:ENSSTOT00000006503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEANGLGSQNFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRATQDFFSTCR
SPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREERDLER
LRDPEVVTSELGYVFQAITLTRQQLAGRVPLIGFAGAPWTLMTYMVEGGSSSTMAQSKRW
LYQRPQASHQLLRILTDALVPYLVGQVAAGAQALQLFESHAGHLGPQLFNKFALPYIRDV
AKRVKARLQEAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARERVGKSVT
LQGNLDPCALYASEEEIGRLVQQMLDDFGPKRYIANLGHGLYPDMDPEHVGAFVDAVHRH
SRLLRQN
Download sequence
Identical sequences I3M817
XP_005318020.1.77405 ENSSTOP00000005817 ENSSTOP00000005817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]