SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000005838 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000005838
Domain Number 1 Region: 139-313
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 1.34e-49
Family Acyl-CoA thioesterase 0.00016
Further Details:      
 
Domain Number 2 Region: 29-135
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 2.04e-37
Family Acyl-CoA thioesterase 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000005838   Gene: ENSSTOG00000006540   Transcript: ENSSTOT00000006529
Sequence length 320
Comment pep:known_by_projection scaffold:spetri2:JH393324.1:7166914:7180410:1 gene:ENSSTOG00000006540 transcript:ENSSTOT00000006529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPQVPEDGQGSGDSGDPSGDLRSVLVTSVLSLEPLDEDLFRGRHYWVPTTQRLFGGQI
VGQALVAAAKSVSEDIHVHSLHCYFVRAGDPKVPVLYQVERTRTGSSFSVRSVKAVQHGK
PIFIFQASFQQTQPSPVQHQFSMPAVPPPEELLDHQALIDQYLRDPNLKEKYRVGLNRIA
AQEVPIEIKLVNPPTLSQLQRMEPKQMFWVRARGYIGEGDIKMHCCVAAYISDYAFLGTA
LLPHQWKHKVHFMVSLDHSMWFHAPFRADHWMLYECESPWAGGSRGLVHGRLWRRDGILA
VSCAQEGVIRVKPRVSESKL
Download sequence
Identical sequences I3M835
ENSSTOP00000005838 ENSSTOP00000005838 XP_005325312.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]