SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000005900 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSTOP00000005900
Domain Number - Region: 92-168
Classification Level Classification E-value
Superfamily UROD/MetE-like 0.0889
Family Uroporphyrinogen decarboxylase, UROD 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000005900   Gene: ENSSTOG00000006608   Transcript: ENSSTOT00000006600
Sequence length 197
Comment pep:known_by_projection scaffold:spetri2:JH393415.1:3807148:3847035:1 gene:ENSSTOG00000006608 transcript:ENSSTOT00000006600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTSLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMASGAANVVGPKICLEDN
VLMSGVKNNVGRGINVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTY
DDGATKLNDEARRLISELGSTSINTLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYE
GWPEVVEMEGCIPQKQD
Download sequence
Identical sequences ENSSTOP00000005900 ENSSTOP00000005900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]