SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000006193 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000006193
Domain Number 1 Region: 403-429,467-571,685-800
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.02e-50
Family Phosphate binding protein-like 0.0000833
Further Details:      
 
Domain Number 2 Region: 281-383
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.0000022
Family L-arabinose binding protein-like 0.0097
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000006193
Domain Number - Region: 563-661
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00497
Family Voltage-gated potassium channels 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000006193   Gene: ENSSTOG00000006913   Transcript: ENSSTOT00000006930
Sequence length 992
Comment pep:known_by_projection scaffold:spetri2:JH393398.1:433661:440378:1 gene:ENSSTOG00000006913 transcript:ENSSTOT00000006930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGLALGLAPGSARGHPQPCGVLARLGSSVRLGALLPRASVARARARTALARAALEPPLPH
NLSLELVAAAPPARDPASMARVLCQKLASPGVAAWLAFPESRPELLQLHFLAAATETPVL
SVLRREARAPLGAPTPFHLQLDWASPLETLLDVLVSLLQAHGWEDVGLVLCRVRDPAGLV
ALWTSRAGWAPRILLDLSRPDVGDVGLRTRLAPLGTPGGGESPVPVAVLLGCDTTHAPQV
LQAAPPGPRWLLGTPLPAEALPTAGLPPGLLALGEVARPSLEATIHDAVELVARALGSAA
RVQPERAHLLAMANCEDREPAGPESPGRFLAQFLANTSFQGRTGPVWVTSTSQVHLSRSF
KVWSLLRDPLGAPAWATVGSWRDGQLDLEPGGTASQLPPPTGARARPKLRVVTLVEHPFV
FAREPDEDGQCPAGQLCLDPGTNDSAMLDALFAALANGSVPHTLRKCCYGYCIDLLERLA
EDAPFDFELYIVGDGKYGALREGRWTGLVGDLLAGRAHMAVTSFSINSARSQVMDFTSPF
FSTSLGILVRARDTASPIGAFMWPLHWSMWLGVFAALHLTALFLTLYEWRSPYGLTPRGR
NRGTVFSYSSALNLCYAILFGRTVSSKTPKCPTGRFLMNLWAIFCLLVLSSYTANLAAVM
VGDKTFEELSGIHDPKLHHPSQGFRFGTVRESSAEAYIKASFPEMHAHMRRHSAPTTPDG
VAMLTSDPPKLNAFIMDKSLLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLTSNLS
EFISRYKSSGFIDLLHDKWYKMVPCGKRVFAVTETLQMGIYHFSGLFVLLCLGLGSALLS
SLCEHVFFRLVLPRIRRGSRLQYWLHTSQKIHRALNTDRPEGQRERLEPEQQEQQDTSAY
PEGPGRWKRVRRAVGKERRVRFLLEPGMAGAQPPPTAAPATSPSGELEELERHIEAVRER
LRRALMQRGELLVRLGDGARHRPLRLLQAQAA
Download sequence
Identical sequences ENSSTOP00000006193 ENSSTOP00000006193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]