SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000006234 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000006234
Domain Number 1 Region: 18-638
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 1.44e-225
Family Aconitase iron-sulfur domain 2.38e-16
Further Details:      
 
Domain Number 2 Region: 643-897
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 5.89e-84
Family LeuD-like 0.000000000276
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000006234   Gene: ENSSTOG00000006942   Transcript: ENSSTOT00000006974
Sequence length 899
Comment pep:known_by_projection scaffold:spetri2:JH393334.1:1100267:1132910:1 gene:ENSSTOG00000006942 transcript:ENSSTOT00000006974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNPFSHLSEPLDPAQPGKKFFNLNKLEDSRYVRLPFSIRVLLEAAVRNCDEFLVKKNDI
ENILNWNIMQHKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGDPEKINPVCPA
DLVIDHSIQVDFNRRADSLQKNQDLEFERNKERFEFLKWGSQAFRNMRIIPPGSGIIHQV
NLEYLARVVFDQDGYYYPDSLVGTDSHTTMIDGLGVLGWGKCTSTLFVAGVGGIEAEAVM
LGQPISMVLPQVIGYRLMGKPQALVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSI
ADRATIANMCPEYGATAAFFPVDEVSIKYLVQTGRDENKVKHIKKYLQAVGMFRDFSDCS
QDPDFTQVVELDLKTVVPCCSGPKRPQDKVAVSDMKKDFETCLGAKQGFKGFQVAADHHN
DQKTFIYNNNEFTLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVDAGLNVKPYIKTS
LSPGSGVVTYYLRESGVMPYLSQLGFDVVGYGCMTCIGNSGPLPEPVVEAITQGDLVAVG
VLSGNRNFEGRVHPNTRANYLASPPLVIAYAIAGTIRIDFEKEPLGTNAKGQQVFLKDIW
PTRDEIQAVERQYVIPGMFKEVYQKIETVNESWNALGAPSDKLYFWNPKSTYIKSPPFFE
NLTLDLQPPKSIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRGLTPRDFNSYG
SRRGNDAIMARGTFANIRLLNKFLNKQAPQTIHLPSGETLDVFDAAERYQQAGLPLIVLA
GKEYGSGSSRDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGENADTLGLT
GRERYTIVIPENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFHNGGILNYMIRKMAR
Download sequence
Identical sequences ENSSTOP00000006234 ENSSTOP00000006234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]