SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000006602 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSTOP00000006602
Domain Number - Region: 50-96
Classification Level Classification E-value
Superfamily 2-methylcitrate dehydratase PrpD 0.0432
Family 2-methylcitrate dehydratase PrpD 0.1
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000006602   Gene: ENSSTOG00000007398   Transcript: ENSSTOT00000007389
Sequence length 257
Comment pep:known_by_projection scaffold:spetri2:JH393351.1:508482:511466:-1 gene:ENSSTOG00000007398 transcript:ENSSTOT00000007389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKIGSRRWMLQLIMQLGSVLLTRCPFWGCFSQLMLYAERAEARRKPDIPVPYLYFDMG
AAVLCASFMSFGVKRRWFALGAALQLAISTYAAYIGGYVHYGDWLKVRMYSRTVAIIGGF
LVLASGAGELYRRKPRSRSLQSTGQVFLGIYLICVAYSLQHSKEDRLAYLNHLPGGELMI
QLFFVLYGILALAFLSGYYVTLAAQILAVLLPPVMLLIDGNIAYWHNMRRVEFWNQMKLL
GESVGIFGAAVILATDG
Download sequence
Identical sequences I3M9M3
ENSSTOP00000006602 XP_005328156.1.77405 ENSSTOP00000006602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]