SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000006632 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000006632
Domain Number 1 Region: 402-575,604-665
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.12e-44
Family Voltage-gated potassium channels 0.0019
Further Details:      
 
Domain Number 2 Region: 669-854
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.43e-44
Family cAMP-binding domain 0.00047
Further Details:      
 
Domain Number 3 Region: 38-127
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.71e-21
Family Flavin-binding PAS domain 0.00000483
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000006632   Gene: ENSSTOG00000007425   Transcript: ENSSTOT00000007424
Sequence length 1159
Comment pep:known_by_projection scaffold:spetri2:JH393337.1:6380579:6412165:-1 gene:ENSSTOG00000007425 transcript:ENSSTOT00000007424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVRRGHVAPQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVM
QRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDG
AVIMFILNFEVVMEKDMVGSPARDTNHRGPPTSWLAPGRAKTFRLKLPALLALTTRESAG
RPGSAGSVGAPGAVVVDVDLTPAAPSSESLALDEVSAMDNHVVGLGPAEERRALVGPGSP
TVSAPGPHPSPRAHSLNPEASGSSCSLARTRSRESCASVRRASSADDIEAMRAGALPPPP
RHASTGAMHPLRSGLLNSTSDSDLVRYRTISKIPQITLNFVDLKGDPFLASPTSDREIIA
PKIKERTHNVTEKVTQVLSLGADVLPEYKLQAPRIHRWTILHYSPFKAVWDWLILLLVIY
TAVFTPYSAAFLLKETEEGSQAPDCGYACQPLAVVDLIVDIMFIVDILINFRTTYVNANE
EVVSHPGRIAVHYFKGWFLIDMVAAIPFDLLIFGSGSEELIGLLKTARLLRLVRVARKLD
RYSEYGAAVLFLLMCTFALIAHWLACIWYAIGNMEQPHMDSRIGWLHNLGDQIGKPYNSS
GLGGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSLMYASIFGNVS
AIIQRLYSGTARYHTQMLRVREFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGF
PECLQADICLHLNRSLLQHCKPFRGATKGCLRALAMKFKTTHAPPGDTLVHAGDLLTALY
FISRGSIEILRGDVVVAILGKNDIFGEPLNLYARPGKSNGDVRALTYCDLHKIHRDDLLE
VLDMYPEFSDHFWSSLEITFNLRDTNMIPGSPGSAELEGGFNRQRKRKLSFRRRTDKDAE
QPGEMSALGPGRAGAGQSSRGRPGESWGESPSSGPSSPESSEDEEPGRSSSPLRLVPFSS
PRPPGEPLGGEPLTEDREKSSDTCNPLSGAFSGVSNIFSFWGDSRGRQYQELPRCPAPTP
SLLNIPLSSPNRRPRGDVESRLDALQRQLNRLETRLSADMATVLQLLQRQMTLVPPAYSA
VTTPGPGPTSTSPLLPVGPIPTLTLDSLSQVSQFMAFEELPPGVPELPQEGPTRRLSLPG
QLGALTSQPLHRHGSDPGS
Download sequence
Identical sequences A0A287DCA9
ENSSTOP00000006632 XP_005326715.1.77405 ENSSTOP00000006632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]