SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000006697 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000006697
Domain Number 1 Region: 93-151
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.00000425
Family VPS37 C-terminal domain-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000006697   Gene: ENSSTOG00000007504   Transcript: ENSSTOT00000007494
Sequence length 358
Comment pep:known_by_projection scaffold:spetri2:JH393391.1:1843335:1849335:1 gene:ENSSTOG00000007504 transcript:ENSSTOT00000007494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLKDKTLQELEEMQNDPEAIDRLALESPEVQDLQLEREMALATNRSLAERNLEFQGPL
EISRSNLSDKYQELRRLVERCQEQKAKLEKFSSAFQPGTLLDLLQIEGMKIEEESEAMAE
KFLEGEVPLEKFLEDFSSMRMLSHLRRVRVEKLQDVVRRPRASQELAGDGPPPRPPPLPL
RPGPQATPPVAEEQPPPQPSVVPPYPLPYSPSPALPMGPTAQGALQPAPFPVVAQPSASY
SGPLGPAYPSAQPGPRSAAGYPWSPQRSTPPRPGYPVALTSTSGPGYPLAGGRAPSPGYP
QQPPYLPTGGKPPYPTQPLLPGFPGQPQPSVPPRPPYPPGPTPPYGFSPPPGPAWPGY
Download sequence
Identical sequences I3M9U9
XP_021586284.1.77405 ENSSTOP00000006697 ENSSTOP00000006697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]