SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000006722 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000006722
Domain Number 1 Region: 125-263
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.96e-19
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 2 Region: 678-744
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000827
Family VWC domain 0.0055
Further Details:      
 
Domain Number 3 Region: 628-686
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000983
Family VWC domain 0.0058
Further Details:      
 
Domain Number 4 Region: 493-561
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000188
Family VWC domain 0.029
Further Details:      
 
Domain Number 5 Region: 384-441
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000023
Family VWC domain 0.04
Further Details:      
 
Domain Number 6 Region: 434-495
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000178
Family VWC domain 0.05
Further Details:      
 
Domain Number 7 Region: 567-625
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000303
Family VWC domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000006722   Gene: ENSSTOG00000007513   Transcript: ENSSTOT00000007522
Sequence length 864
Comment pep:known_by_projection scaffold:spetri2:JH393391.1:1746067:1853703:1 gene:ENSSTOG00000007513 transcript:ENSSTOT00000007522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWAGLLLRAACAALLLPETPARGYTGRKPPGHFAPERRRLGPHVCLSGFGSGCCPGWAPS
MGSGHCTLPLCSFGCGSGVCIAPNVCSCQDGEQGATCPEAHGPCGEYGCDLTCNHGGCQE
VARVCPLGFSMTETAVGIRCTDIDECLSSSCEGHCVNTEGGFVCECGPGMQLAADRHSCQ
DTDECLGTPCQQRCRNSIGSYKCSCRTGFHLHGNRHSCVDVNECRRPQERRVCHHSCHNT
VGSFLCSCRPGFRLRADRVSCEALPKAVQAPSAILQPRQHPNKMPLLLPELGRPALSPGH
SPPPGAPGPPAGTRTTHLPSPTSPPPSFFPSAPTRLLSTLMATPGPSAALLRTPRPPSFL
QGEVVGTPSSPRGPGSPRLAARPSPCWHLGAVHESGSHWTEPRCSQCWCEDGQVTCREVR
CEAACSHPIPPRDGGCCPLCTGCFYSGAVRAEGDVFSPPNENCTVCVCLAGNVSCISPEC
PPGPCETLPQSDCCTCVPVRCYFRGRWYADGAVFSGGGDDCTTCVCQKGEVECSFTPCPE
LDCPREDRWLGPGQCCFTCREPTPTTGCSLDDNGVEFPIGQIWSPGDPCELCICQADGSV
SCRTTDCVDSCPHPIRIPGQCCPDCSAGCTYMGRIFYNNETFPSALDPCLSCICLLGSVA
CSPVDCPIACTYPFHPDGECCPVCRDCNYEGRKVVNGQVFTLDDEPCTRCTCQLGEVSCE
KVPCQQACTDSSPPPGDCCSSCPDSVFPLGETQGLTPHGDVVLGKAARSPRGDTQVPINC
SSCLAPPPAAPPRPALHLFQLLRRTNWSNVQTSPTGPSTAQASPSPPLSHSGEVLELPGA
SPRILPQPWCPEGATLLQLASPGS
Download sequence
Identical sequences ENSSTOP00000006722 ENSSTOP00000006722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]