SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000006935 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000006935
Domain Number 1 Region: 248-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000221
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 2 Region: 281-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000887
Family Classic zinc finger, C2H2 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000006935   Gene: ENSSTOG00000007751   Transcript: ENSSTOT00000007748
Sequence length 317
Comment pep:known_by_projection scaffold:spetri2:JH393294.1:10470439:10476648:1 gene:ENSSTOG00000007751 transcript:ENSSTOT00000007748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLSPALAGRVSAPTPDRTPPCFPDSGDCLFQTDMDVLPMCSIFQELQIVHETGYFSALP
SLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEESELKISSSPP
EDTLISPSFSYNLETNSLNSDVSSESSDSSEELSPTTKFTSDPISEVLVNSGNLSSSVTS
TPPSSPELSREPSQLWGCVPGELPSPGKVRSGTSGKPGDKGSGDASPDGRRRVHRCHFNG
CRKVYTKSSHLKAHQRTHTGEKPYRCSWEGCEWRFARSDELTRHFRKHTGAKPFKCSHCD
RCFSRSDHLALHMKRHL
Download sequence
Identical sequences I3MAC2
ENSSTOP00000006935 XP_005320385.1.77405 ENSSTOP00000006935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]