SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000006989 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000006989
Domain Number 1 Region: 111-247
Classification Level Classification E-value
Superfamily dUTPase-like 3.4e-46
Family dUTPase-like 0.000000199
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000006989   Gene: ENSSTOG00000007811   Transcript: ENSSTOT00000007806
Sequence length 252
Comment pep:novel scaffold:spetri2:JH393281.1:10671005:10681314:1 gene:ENSSTOG00000007811 transcript:ENSSTOT00000007806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTALLPRPALGCHFSPSLLRLAFKDARRKQLGAWASRLSRPGPPFGPTQLAPPRPLSSAG
TPFPEASRGAGGGSERGWREISEFGGLLAASEEVTAISPSKRARPAEDGGLRLRFVRLSE
HATAPTRGSARAAGYDLYSAYDYIVPPMEKALVKTDIQIALPSGCYGRIAPRSGLAAKYF
IDVGAGVIDEDYRGNIGVVLFNFGKEKFEEVKKGDRIAQLICERIFYPDIEEVQVLNDTE
RGSGGFGSTGKN
Download sequence
Identical sequences ENSSTOP00000006989 ENSSTOP00000006989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]