SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000007082 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000007082
Domain Number 1 Region: 2-429
Classification Level Classification E-value
Superfamily ALDH-like 2.88e-128
Family ALDH-like 0.0000000000347
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000007082   Gene: ENSSTOG00000007914   Transcript: ENSSTOT00000007914
Sequence length 487
Comment pep:known_by_projection scaffold:spetri2:JH393691.1:131944:150302:-1 gene:ENSSTOG00000007914 transcript:ENSSTOT00000007914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENQVQQLRQTFRSGRSRPLRFRLQQLEALRRMVQEREKDILSAIAADLCKSEFNAYSQE
VITVLGEIDLMLGNLHEWVTAKPVKKNLLTMMDEAYIQPEPLGVILIIGAWNYPFVLTMQ
PLVGAIAAGNAVIIKPSELSENTAKILAKLLPQYLDQDLYAVVNGGVEETTELLKQRFDH
ILYTGNTAVGKIVMEAAAKYLTPVTLELGGKSPCYIDKDCDLDVVCRRITWGKYMNCGQT
CIAPDYILCEASLQSQIVQKIKETVKEFYGENIKESPDYERIINLRHFKRIQSLLEGQKI
AFGGETDEATRYIAPTVLTDVDPETRVMQEEIFGPVLPIVPVKNADEAINFINKREKPLA
LYIFSHNNKLIKRMIDETSSGGVTGNDVIMHFTLNSLPFGGVGSSGMGAYHGKHSFDTFS
HQRPCLLKSLKREGANKLRYPPNSQSKVDWAKFFVLKQFNKGKLGLLLLTFLGVVAAVII
KKSLKYW
Download sequence
Identical sequences ENSSTOP00000007082 ENSSTOP00000007082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]