SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000007111 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000007111
Domain Number 1 Region: 177-584
Classification Level Classification E-value
Superfamily ALDH-like 2.09e-91
Family ALDH-like 0.000000116
Further Details:      
 
Domain Number 2 Region: 2-167
Classification Level Classification E-value
Superfamily Carbamate kinase-like 4.45e-29
Family PyrH-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000007111   Gene: ENSSTOG00000007930   Transcript: ENSSTOT00000007944
Sequence length 609
Comment pep:known_by_projection scaffold:spetri2:JH393446.1:3779275:3800333:1 gene:ENSSTOG00000007930 transcript:ENSSTOT00000007944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIVNTNDAVVPPAEPNSDLQGVNVISVKDN
DSLAARLAVEMKTDLLIVLSDVEGLFDSPPGSDDAKLIDIFYPGDQQSVTFGTKSRVGMG
GMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAGPTVEQQ
GEMARSGGRTLATLEPEQRAEIIHHLADLLTDQRDEILLANKKDLEEAEGRLAAPLLKRL
SLSTSKLNSLAIGLRQIAASSQDSVGRVLRRTRIAKNLELEQVTVPIGVLLVIFESRPDC
LPQVAALAIASGNGLLLKGGKEAAHSNRILHLLTQEALSIHGVKEAVQLVNTREEVEDLC
RLDKLIDLIIPRGSSQLVRDIQKAAKGIPVMGHSEGICHLYVDSEASVDKVTRLVRDSKC
EYPAACNALETLLIHRDLLRTPLFDQIIDMLRVEQVKIHAGPKFASYLTFSPSEVKSLRT
EYGDLELCIEVVDSVQEAIDHIHKYGSSHTDVIVTENENTAEFFLQHVDSACVFWNASTR
FSDGYRFGLGAEVGISTSRIHARGPVGLEGLLTTKWLLRGQDHVVSDFSEHGSLKYLHEN
LPVPQRNTN
Download sequence
Identical sequences ENSSTOP00000007111 ENSSTOP00000007111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]