SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000007126 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000007126
Domain Number 1 Region: 7-357
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 1.09e-71
Family ADP-ribosylglycohydrolase 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000007126   Gene: ENSSTOG00000007972   Transcript: ENSSTOT00000007962
Sequence length 360
Comment pep:known_by_projection scaffold:spetri2:JH393282.1:309773:321999:1 gene:ENSSTOG00000007972 transcript:ENSSTOT00000007962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCGATSEMEKFTAAMLLGSVGDALGYANVCRENSALGSVQDELRKIGGLDHLVLSPGKWP
VSDNTIMHLATAEALATDFWCLDDLYREMVRCYVEAMEKLPERRPDPATVEGCSLLKPDN
YLLAWHTPFSEKGSGFGAATKAMCIGMRYWKPERLGTLIEVSIECGRMTHNHPTGFLGSL
CTALFASYAVQGKPLVQWGRDMLKVVPMAEEYCRKTIRHMAEYQEHWFYFEAKWQFYLEE
RKISEDSGNEATFPENYDAEERDKTYKKWSSEGRGGRRGHDAPMIAYDALLAAGGSWTEL
CQRAMLHGGESGATGAIAGCLFGLLHGLDAVPRGLYQELEHRPRLESVGAALHRLSTEEK
Download sequence
Identical sequences ENSSTOP00000007126 ENSSTOP00000007126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]