SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000007138 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000007138
Domain Number 1 Region: 133-381
Classification Level Classification E-value
Superfamily vWA-like 2.89e-81
Family Integrin A (or I) domain 0.0000000228
Further Details:      
 
Domain Number 2 Region: 377-467
Classification Level Classification E-value
Superfamily Integrin domains 3.98e-31
Family Integrin domains 0.0000919
Further Details:      
 
Domain Number 3 Region: 633-715
Classification Level Classification E-value
Superfamily Integrin beta tail domain 3.01e-18
Family Integrin beta tail domain 0.00041
Further Details:      
 
Domain Number 4 Region: 26-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000241
Family Plexin repeat 0.0007
Further Details:      
 
Domain Number 5 Region: 592-632
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000949
Family Integrin beta EGF-like domains 0.0028
Further Details:      
 
Domain Number 6 Region: 549-587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000053
Family Integrin beta EGF-like domains 0.013
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000007138
Domain Number - Region: 518-549
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0307
Family Integrin beta EGF-like domains 0.033
Further Details:      
 
Domain Number - Region: 474-501
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0781
Family Integrin beta EGF-like domains 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000007138   Gene: ENSSTOG00000007965   Transcript: ENSSTOT00000007976
Sequence length 799
Comment pep:known_by_projection scaffold:spetri2:JH393535.1:417767:531007:1 gene:ENSSTOG00000007965 transcript:ENSSTOT00000007976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRAPAPLYACLLGLCALVPPLPGLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSV
TSRCDLRANLIRNGCGGEIESPASSARVLRNLPLSSEGSSAAGSDVIQMAPQEIAVSLRP
GDQTTFQLQVRQVEDYPVDLYYLMDLSLSMKDDLDNIRSLGTKLAEEMRKLTSNFRLGFG
SFVDKDISPFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVS
RNRDAPEGGFDAVLQASVCKEKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQC
HLNEANEYTASNQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEIL
HGDSKNIIQLIINAYNSIRSKVELSVWDQPEDLNLFFTATCQDGVSYPGQRKCEDLKIGD
TASFEVSVEARSCPSRPVEHAFTLRPVGFRDSLQVRVTYNCTCGCSAGLEPDSARCSGNG
TYICGLCECNPSYLGTRCECQEGENQSVYQNLCREAEGKPLCSGRGECSCNQCSCFESEF
GKIYGPFCECDNFSCARNKGVLCSGHGECHCGECKCHAGYIGDNCNCSTDISTCQAKDGQ
ICSNRGNCICGQCQCTEPGAFGETCEKCPTCPDACSTKRDCVECLLLHSGKPDNQTCQHL
CKDEVITWVDTIVKDDQEAVLCFYKTAKDCIMTFSYADLPSGKTNLTVLREPECGTAPNA
MTILLAVVGSILLIGIALLAIWKLLVTIHDRREFAKFQSERSRARYEMASNPLYRKPIST
HTVDFTFNKFNKSYNGTVD
Download sequence
Identical sequences A0A287CYP1
ENSSTOP00000007138 XP_005338932.1.77405 ENSSTOP00000007138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]