SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000007289 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSTOP00000007289
Domain Number - Region: 194-312
Classification Level Classification E-value
Superfamily TrmE connector domain 0.0445
Family TrmE connector domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000007289   Gene: ENSSTOG00000008139   Transcript: ENSSTOT00000008139
Sequence length 316
Comment pep:known_by_projection scaffold:spetri2:JH393335.1:8605045:8633149:-1 gene:ENSSTOG00000008139 transcript:ENSSTOT00000008139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEISRIQYEMEYTEGISQRMRVPEKLKVAPPNADLEQGFQEGVPNASVIMQVPERIVVA
GNNEDISFSRPADLDLIQSTPFKPLALTTPPRVLTLSERPLDFLDLERSPPTPQNEEIRA
VGRLKRERSMSENAVRQNGQLVRNDSMWHRSDSAPRNKISRFQASISAPEYTVTPSPQQA
RVCPSHMLPEDGANLSSARGILSLIQSSTRRAYQQILDVLDENRRPVLRGGSAAATSNPH
HDNVRYGISNIETTIEGSSDDMTVVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYS
ITVAFWLLNSWLWFRR
Download sequence
Identical sequences A0A287D5X2
ENSSTOP00000007289 ENSSTOP00000007289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]