SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000007484 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000007484
Domain Number 1 Region: 653-714
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000209
Family VWC domain 0.0043
Further Details:      
 
Domain Number 2 Region: 732-801
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000471
Family VWC domain 0.084
Further Details:      
 
Domain Number 3 Region: 820-884
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000272
Family VWC domain 0.039
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000007484
Domain Number - Region: 2-75
Classification Level Classification E-value
Superfamily FnI-like domain 0.000136
Family VWC domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000007484   Gene: ENSSTOG00000008321   Transcript: ENSSTOT00000008351
Sequence length 903
Comment pep:known_by_projection scaffold:spetri2:JH393388.1:5498887:5507201:-1 gene:ENSSTOG00000008321 transcript:ENSSTOT00000008351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XGGKVYALDETWHPDLGEPFGVMRCVLCACEAPQWGRRGRGPGRVSCKNIKPECPTLACG
QPHQLPGHCCQTCPQERSNSEQQRPGLSFEYPRDPEHRSYSDRGEPGAEERARADGHTDF
VALLTGPRSQAVARARVSLLRSSLRFSISYRRLDRPSRVRFSDSTGSILFEHPASPTQDG
LVCGVWRAVPRLSLRLLRAEQLHVALVTPTHPSGEVWGPLIRHRALAAETFSAILTLEGL
QQQGVGGITLLTLSDTEDSLHFLLLFRGLLEPKTTQVPLRLQILHQGQLLRELQANASAQ
EPGFAEVLPNLTAQEMDWLVLGELQMALERADGPEMRISGHIAARQSCDVLQSVLCGADA
LIPVQTGAAGSASLTLLGNGSLIYQVQVVGTGSEMVAMTLETKPQRRNQRTVLCHMAGFQ
LGGHMAVGVCPGLGARGTHMLLQNELFLNVGTKDFPDGELRGHVATLPYSGHSARHDTLP
VPLAGALVLPPVQSQAAGHAWFSLDTHCHLHYEVLLAGLGGSEQGTVTAHLLGPPGIPGP
RRLLKGFYGSEAQGVVKDLEPELLRHLAQGTASLLITTKGSPRGELRGQVHVRNQCEVGG
LRLAAAGAEGAGASGVSVAAAAALPALPVQAVPGPEAPAPVKPGGPGRPRDPNTCFFEGQ
QRPHGARWAPNYDPLCSLCTCQRRTVICDPVVCPPPSCPHPVQAPDQCCPVCPEKQDVRD
LPGLPRSRDPGEGCYFDGDRSWRAAGTRWHPVVPPFGLIKCAVCTCKGGTGEVHCEKVQC
PRLACAQPIRANPTDCCKQCPVGPGAHPQLGDPMQADGPRGCRFAGQWFPESQSWHPSVP
PFGEMSCITCRCGAGVPHCERDDCSLSLSCSSGKESRCCSHCTPQRPPETRTVPELEKEA
EGS
Download sequence
Identical sequences ENSSTOP00000007484 ENSSTOP00000007484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]