SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000007523 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000007523
Domain Number 1 Region: 357-616
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.6e-80
Family Eukaryotic proteases 0.00013
Further Details:      
 
Domain Number 2 Region: 195-299
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-34
Family Kringle modules 0.00045
Further Details:      
 
Domain Number 3 Region: 37-90
Classification Level Classification E-value
Superfamily Kringle-like 7.71e-18
Family Fibronectin type II module 0.0069
Further Details:      
 
Domain Number 4 Region: 98-130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000153
Family EGF-type module 0.04
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000007523
Domain Number - Region: 175-204
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0754
Family EGF-type module 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000007523   Gene: ENSSTOG00000008389   Transcript: ENSSTOT00000008394
Sequence length 617
Comment pep:known_by_projection scaffold:spetri2:JH393407.1:1687646:1694782:-1 gene:ENSSTOG00000008389 transcript:ENSSTOT00000008394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALLLLGSLLVSLEPVLSIPPWKAHRVHKQGSDEPTVVLTVTGEPCHFPFQYHRQLYHK
CIHKGWPGPRPWCATTPNFDQDQQWAHCLEPKKVKGSKHSPCHKGGTCVNMPKGPHCLCP
EHLTGKHCQKEKCFEPQLLRFFHENEIWLRSGPEGVAKCHCKGPDAHCKPLASHACHTNL
CLNGGRCLEAEGQSLCHCPVGYTGPFCDLDVEANCYHDRGLSYRGKARTTLSGATCQRWD
SEATYRNVTAEQALSRGLGHHTFCRNPDNDTRPWCFVWKGDRLSWEYCDLAQCWATIQAA
PPLMDTLGRQDLPMPQPSALQKPQPTTQSPPHSRTPAWALPTAPSKQPTRLSRTSPPSCG
QRLRKSLSPLSRVVGGLVALPGAHPYIAALYWGDSFCAGSLIAPCWVLTAAHCLQNRPAP
EDLTVVLGQELHNQTCKQCQTLGVRSYRLHEAFSSNTYQHDLALLRLQESADGSCARLSP
YVQPVCLPSGTAQTSEPEDMLCQVAGWGHQYEGAEDYSTFLQEAQVPFISLEHCSASEVH
GDAILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAENRLTLRGVISWGSGCGDRNKPGV
YTDVASYVTWIQEHIAS
Download sequence
Identical sequences ENSSTOP00000007523 ENSSTOP00000007523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]