SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000007595 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000007595
Domain Number 1 Region: 3-247
Classification Level Classification E-value
Superfamily Carbonic anhydrase 5.1e-91
Family Carbonic anhydrase 0.000000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000007595   Gene: ENSSTOG00000008481   Transcript: ENSSTOT00000008475
Sequence length 268
Comment pep:known_by_projection scaffold:spetri2:JH393280.1:5208466:5227000:1 gene:ENSSTOG00000008481 transcript:ENSSTOT00000008475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLWESVDLLPGGDRQSPINIRWKDSVYDPGLKPLTISYDPATCLHIWNNGYSFLVEFEDS
TDKSVIEGGPLEHIYRLKQFHFHWGAIDAWGSEHTVDSKCYPAELHLVHWNAVKFETFED
AALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDTLVEFGSFDPSCMMPVCPDYWT
YSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMN
RTVRSSFRHDYVLNIQKNPKTIASQMTP
Download sequence
Identical sequences ENSSTOP00000007595 ENSSTOP00000007595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]