SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000007624 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000007624
Domain Number 1 Region: 5-434
Classification Level Classification E-value
Superfamily ALDH-like 2.23e-132
Family ALDH-like 0.00000000000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000007624   Gene: ENSSTOG00000008487   Transcript: ENSSTOT00000008506
Sequence length 453
Comment pep:known_by_projection scaffold:spetri2:JH393691.1:71101:77545:1 gene:ENSSTOG00000008487 transcript:ENSSTOT00000008506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKISDVVKRARAAFNSGLTRPLQFRIQQLEALRRMIQERQADITEALAADLHKNEWTAY
GEEVGYVLEEIAYMIKNLHEWVKDEPVEKTPETQQDESYIHSEPLGVVLIIGTWNYPFNL
VVQPMAGAIAAGNAVVLKPSELSENMANLLATILPQYIDKELYPVINGGVPETTEVLKER
FDHIFYTGSTGVGKIVMTAAAKHLTPVTLELGGKSPCYVDKDCNLDVACRRIAWGKFMNS
GQTCVAPDYILCDPSIQHQIVEKLKKSLKEFYGEDAKKSRDYGRIINARHFQRVMGLIEG
QKVAHGGTGDMASRYIAPTILTDVDPQSQVMQEEIFGPVMPIVCVRSLEEAIQFINQREK
PLALYVFSNNNNVIKKMISETSSGGVTANDVIVHITVHSLPFGGVGHSGMGAYHGRKSFE
TFSHRRSCLVRSLLNDDAHKARYPPSPAKMPWH
Download sequence
Identical sequences I3MBR7
XP_021576616.1.77405 ENSSTOP00000007624 ENSSTOP00000007624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]