SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000007768 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSTOP00000007768
Domain Number - Region: 69-99
Classification Level Classification E-value
Superfamily LysM domain 0.000109
Family LysM domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000007768   Gene: ENSSTOG00000008678   Transcript: ENSSTOT00000008667
Sequence length 306
Comment pep:known_by_projection scaffold:spetri2:JH393279.1:8615811:8621227:-1 gene:ENSSTOG00000008678 transcript:ENSSTOT00000008667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRHQNRSFPLTGVQSSGQVHAFGNCTDTDMLEDEAEVYELRSRGKEKVRRSTSRDRLD
DIIVLTKDIQEGDTLNAIALQYCCTVADIKRVNNLISDQDFFALRSVKIPVKKFSSLAET
LYPPKGRQASRPSSVQYAPEQQEVLPANDCLSSSESAGSFLKEVDRDIEQIVKCTDTKKE
NLNEVVSALTAQQIRFEPDNKNTQRKDPYYGADWGIGWWTAVVIMLIVGIITPVFYLLYY
EILAKVDVSHHSTVDSSHFHSGITAPSQHREMENGIPPTRGIHVGQQDDHKLYREDSQPP
AAQHKT
Download sequence
Identical sequences I3MC25
ENSSTOP00000007768 XP_005315738.1.77405 ENSSTOP00000007768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]