SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000007820 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSTOP00000007820
Domain Number - Region: 41-138
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0034
Family Apolipoprotein A-I 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000007820   Gene: ENSSTOG00000008737   Transcript: ENSSTOT00000008725
Sequence length 217
Comment pep:known_by_projection scaffold:spetri2:JH393469.1:1961243:1978743:-1 gene:ENSSTOG00000008737 transcript:ENSSTOT00000008725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERPGVDMPHVEFKDQEPQAMGEHQQGQEHGEEEAGGGSASANRQLPALEGKPVPYFSSL
ESSIDILKKRAQELIENINESRQKDHALMTNFRDSLKIKVTDLTEKLEERMYQVYNHHSR
IIQERLQEFTQKMAKISNLETELKEVCHTVESVYKDLCVQPEITAEARLINGPGHSSARS
PPCSNNSKPPALLPSPLRNSPNFVTIPEEQTYRDDEC
Download sequence
Identical sequences ENSSTOP00000007820 ENSSTOP00000007820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]